Pali Canon Commentaries1. Commentary on the Brahmajāla Sutta
1. Chú giải Kinh Phạm Võng
1. Brahmajālasuttavaṇṇanā
Commentary on the Story of the Wanderers
Phần Chú giải về câu chuyện của Du sĩ
Paribbājakakathāvaṇṇanā
While this first great council was taking place, at the conclusion of the recitation of the Vinaya, the venerable Mahākassapa, in questioning about the Brahmajāla Sutta, the first sutta of the first collection in the Sutta Piṭaka, said, "Friend Ānanda, where was the Brahmajāla Sutta spoken?" At the conclusion of the statement that begins thus, the venerable Ānanda, clarifying all: where it was spoken, and with reference to what it was spoken, said "Thus have I heard" and the rest. Therefore, it has been said, "The introductory explanation and so on, beginning with 'Thus have I heard' of the Brahmajāla Sutta as well, was spoken by the venerable Ānanda during the first great council."
Trong lần kiết tập Tam tạng vĩ đại đầu tiên này, vào phần kết của việc kiết tập Luật tạng, khi Đại đức Mahākassapa (Đại Ca-diếp) hỏi về bài kinh Phạm Võng (Brahmajāla), bài kinh đầu tiên của bộ kinh đầu tiên trong Tạng Kinh: "Này hiền giả Ānanda (A-nan), kinh Phạm Võng được thuyết ở đâu?", v.v... thì Đại đức Ānanda, trình bày rõ ràng về nơi chốn và nhân duyên thuyết kinh, đã bắt đầu bằng những lời "Tôi nghe như vầy". Vì vậy, có thể nói, "Ngay cả phần mở đầu của kinh Phạm Võng, bắt đầu bằng 'Tôi nghe như vầy', cũng đã được Đại đức Ānanda trình bày trong lần kiết tập đầu tiên."
Imissā paṭhamamahāsaṅgītiyā vattamānāya vinayasaṅgahāvasāne suttantapiṭake ādinikāyassa ādisuttaṃ brahmajālaṃ pucchantena āyasmatā mahākassapena – ‘‘brahmajālaṃ, āvuso ānanda, kattha bhāsita’’nti, evamādivuttavacanapariyosāne yattha ca bhāsitaṃ, yañcārabbha bhāsitaṃ, taṃ sabbaṃ pakāsento āyasmā ānando evaṃ me sutantiādimāha. Tena vuttaṃ ‘‘brahmajālassāpi evaṃ me sutantiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādī’’ti.
1. Herein, "thus" is a particle. "By me" and so on are nominal words. "He becomes one who has entered upon" – here "upon" is a prepositional word, "he becomes" is a verbal word. In this way, for now, the division of words should be understood.
1. Ở đây, "Evaṃ" (như vầy) là một tiểu từ (nipāta). "Me" (tôi), v.v... là những danh từ. Trong câu "Paṭipanno hoti" (đang thực hành), "paṭi" là một giới từ, "hoti" là một động từ cách ngôn, v.v... Trước hết, chúng ta nên hiểu sự phân chia các từ theo cách này.
1. Tattha evanti nipātapadaṃ. Metiādīni nāmapadāni. Paṭipanno hotīti ettha paṭīti upasaggapadaṃ, hotīti ākhyātapadanti. Iminā tāva nayena padavibhāgo veditabbo.
In terms of meaning, however, the word "thus" has a variety of meanings, such as simile, instruction, emphasis, reproach, assent, manner, demonstration, and determination. Likewise, it occurs in the sense of simile in such instances as, "By a mortal born thus, abundant good should be done." In the sense of instruction in such instances as, "Thus should you advance, thus should you retreat." In the sense of emphasis in such instances as, "Thus it is, O Blessed One; thus it is, O Fortunate One." In the sense of reproach in such instances as, "In this very way indeed, this wretched woman speaks praise of that shaveling ascetic, in whatever way." In the sense of assent in such instances as, "Yes, venerable sir, these monks have answered the Blessed One." In the sense of manner in such instances as, "Indeed, venerable sir, in this way do I understand the Dhamma taught by the Blessed One." In the sense of demonstration in such instances as, "Come, young man, approach the ascetic Ānanda. Having approached, ask the ascetic Ānanda in my words about his freedom from illness, his freedom from disease, his lightness of body, strength, and comfortable abiding, saying: 'The young brahmin Subha, Todeyya's son, asks venerable Ānanda about his freedom from illness, his freedom from disease, his lightness of body, strength, and comfortable abiding.' And say this: 'It would be good, venerable Ānanda, if, out of compassion, you would approach the residence of the young brahmin Subha, Todeyya's son.'" In the sense of determination in such instances as, "What do you think, Kālāmas, are these things wholesome or unwholesome? Unwholesome, venerable sir. Blameworthy or blameless? Blameworthy, venerable sir. Condemned by the wise or praised by the wise? Condemned by the wise, venerable sir. When undertaken and practiced, do they lead to harm and suffering, or not? Or how does it appear to you in this matter? When undertaken, venerable sir, and practiced, they lead to harm and suffering. Thus it appears to us in this matter." Here, it should be seen in the senses of manner, demonstration, and determination.
Về ý nghĩa, từ "Evaṃ" có nhiều nghĩa khác nhau như so sánh, chỉ dẫn, tán dương, chê trách, chấp nhận, cách thức, mô tả, khẳng định, v.v... Như trong câu "Evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu" (Với người sinh ra như vậy, nên làm nhiều điều thiện), v.v..., nó mang nghĩa so sánh. Trong câu "Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ" (Ngươi nên tiến tới như vầy, ngươi nên lui lại như vầy), v.v..., nó mang nghĩa chỉ dẫn. Trong câu "Evametaṃ bhagavā, evametaṃ sugatā" (Thật vậy, bạch Thế Tôn, thật vậy, bạch Thiện Thệ), v.v..., nó mang nghĩa tán dương. Trong câu "Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī" (Chính kẻ tiện dân này, bất cứ nơi đâu, đều ca tụng về sa-môn trọc đầu ấy), v.v..., nó mang nghĩa chê trách. Trong câu "Evaṃ, bhante'ti kho te bhikkhū bhagavato paccassosu" (Thưa vâng, bạch Thế Tôn, các vị Tỳ-kheo ấy đã trả lời Thế Tôn), v.v..., nó mang nghĩa chấp nhận. Trong câu "Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī" (Bạch Thế Tôn, con hiểu Pháp do Thế Tôn thuyết giảng như vầy), v.v..., nó mang nghĩa cách thức. Trong câu "Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha. ‘‘Subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’’ti. ‘Evañca vadehi, sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’" (Này thanh niên, hãy đến gặp sa-môn Ānanda, sau khi đến, hãy nhân danh ta hỏi thăm sức khỏe, sự ít bệnh, ít não, sự khinh an, sức mạnh, và an lạc của sa-môn Ānanda. "Thanh niên Subha, con trai của Todeyya, hỏi thăm sức khỏe, sự ít bệnh, ít não, sự khinh an, sức mạnh, và an lạc của Tôn giả Ānanda". Và hãy nói như vầy, "Thật tốt lành thay nếu Tôn giả Ānanda, vì lòng từ bi, đến trú xứ của thanh niên Subha, con trai của Todeyya."), v.v..., nó mang nghĩa mô tả. Trong câu "Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti? Akusalā, bhante. Sāvajjā vā anavajjā vāti? Sāvajjā, bhante. Viññugarahitā vā viññuppasatthā vāti? Viññugarahitā, bhante. Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti? Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī" (Các ngươi nghĩ thế nào, này các Kālāma, các pháp này là thiện hay bất thiện? Bạch Thế Tôn, bất thiện. Có lỗi hay không có lỗi? Bạch Thế Tôn, có lỗi. Bị người trí chê trách hay tán thán? Bạch Thế Tôn, bị người trí chê trách. Nếu được chấp nhận và thực hành trọn vẹn, chúng sẽ đưa đến bất hạnh và đau khổ, hay không? Các ngươi nghĩ thế nào về điều này? Bạch Thế Tôn, nếu được chấp nhận và thực hành trọn vẹn, chúng sẽ đưa đến bất hạnh và đau khổ, chúng con nghĩ như vậy về điều này), v.v..., nó mang nghĩa khẳng định. Ở đây, nó nên được hiểu theo nghĩa cách thức, mô tả và khẳng định.
Atthato pana evaṃ-saddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāranidassanāvadhāraṇādianekatthappabhedo. Tathāhesa – ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti (dha. pa. 53) evamādīsu upamāyaṃ āgato. ‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese. ‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane. ‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe. ‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe. ‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre. ‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha. ‘‘Subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’’ti. ‘‘Evañca vadehi, sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’tiādīsu (dī. ni. 1.445) nidassane. ‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti? Akusalā, bhante. Sāvajjā vā anavajjā vāti? Sāvajjā, bhante. Viññugarahitā vā viññuppasatthā vāti? Viññugarahitā, bhante. Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti? Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe. Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Herein, with the word "thus" in the sense of manner, he illuminates this meaning: Who is capable of fully understanding, in every way, the word of the Blessed One, which is subtle in its various methods, arising from many mental dispositions, endowed with meaning and phrasing, exhibiting various wonders, profound in its exposition, penetration of meaning, and teaching of the Dhamma, coming to the path of hearing of all beings according to their own respective languages? Yet, arousing the desire to hear in every way, 'Thus have I heard', I, too, have heard in one way.
Ở đây, với từ "Evaṃ" theo nghĩa cách thức, ngài làm sáng tỏ ý nghĩa này: Ai có thể hiểu trọn vẹn lời của Thế Tôn, vốn tinh tế trong nhiều phương diện, khởi sinh từ nhiều khuynh hướng khác nhau, đầy đủ ý nghĩa và văn tự, với nhiều oai thần khác nhau, thâm sâu trong việc giảng dạy Pháp và nghĩa, đi vào con đường thính giác của tất cả chúng sinh theo ngôn ngữ riêng của họ? Tuy nhiên, sau khi khơi dậy sự ham muốn lắng nghe, (Đại đức A-nan nói): "Evaṃ me sutaṃ" (Tôi nghe như vầy), ngay cả tôi cũng chỉ nghe theo một cách thức.
Tattha ākāratthena evaṃ-saddena etamatthaṃ dīpeti, nānānayanipuṇamanekajjhāsayasamuṭṭhānaṃ, atthabyañjanasampannaṃ, vividhapāṭihāriyaṃ, dhammatthadesanāpaṭivedhagambhīraṃ, sabbasattānaṃ sakasakabhāsānurūpato sotapathamāgacchantaṃ tassa bhagavato vacanaṃ sabbappakārena ko samattho viññātuṃ, sabbathāmena pana sotukāmataṃ janetvāpi ‘evaṃ me sutaṃ’ mayāpi ekenākārena sutanti.
In the sense of demonstration – removing himself, 'I am not self-existent, this has not been realized by me' – 'Thus have I heard', 'By me, too, has it been heard in this way', he now demonstrates the entire sutta that is to be spoken.
Theo nghĩa mô tả, (Đại đức A-nan) nói: "Tôi không phải là bậc Tự Giác Ngộ, điều này không phải do tôi tự chứng", tự giải thoát mình, (và nói) – ‘Evaṃ me sutaṃ’ (Tôi nghe như vầy), ‘mayāpi evaṃ suta’ (tôi cũng nghe như vậy), bây giờ ngài mô tả toàn bộ bài kinh cần phải nói.
Nidassanatthena – ‘‘nāhaṃ sayambhū, na mayā idaṃ sacchikata’’nti attānaṃ parimocento – ‘evaṃ me sutaṃ’, ‘mayāpi evaṃ suta’nti idāni vattabbaṃ sakalaṃ suttaṃ nidasseti.
In the sense of determination – "This is the foremost, monks, among my disciples who are monks, of those who have heard much, that is, Ānanda; of those who are mindful, of those who possess presence of mind, of those who have resolution, of those who are attendants, that is, Ānanda." Thus by the Blessed One – "The venerable Ānanda is skilled in meaning, skilled in Dhamma, skilled in phrasing, skilled in linguistic expression, skilled in what precedes and follows." Thus, demonstrating the power of his retention in accordance with the praise of the General of the Dhamma, he arouses the desire to hear in beings – 'Thus have I heard', and indeed, whether in meaning or in phrasing, it is not less, not more, it should be seen exactly thus, not otherwise.
Theo nghĩa khẳng định: "Này các Tỳ-kheo, đây là bậc tối thượng trong số các đệ tử Tỳ-kheo của ta, những người nghe nhiều, đó là Ānanda, những người có sự vận hành tốt, những người có niệm tốt, những người có sự kiên trì tốt, những người phục vụ tốt, đó là Ānanda." Như vậy, Thế Tôn đã tán thán (Đại đức A-nan): "Đại đức Ānanda thiện xảo về nghĩa, thiện xảo về Pháp, thiện xảo về văn tự, thiện xảo về từ nguyên, thiện xảo về trước sau". Và tương xứng với sự tán thán của vị Pháp tướng (Xá-lợi-phất), ngài trình bày sức mạnh ghi nhớ của mình, khơi dậy sự ham muốn lắng nghe của chúng sinh: ‘Evaṃ me sutaṃ’ (Tôi nghe như vầy), và điều đó, về nghĩa hay về văn tự, không thiếu, không thừa, nên được hiểu như vậy, không khác."
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.223). Evaṃ bhagavatā – ‘‘āyasmā ānando atthakusalo, dhammakusalo, byañjanakusalo, niruttikusalo, pubbāparakusalo’’ti (a. ni. 5.169). Evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti – ‘evaṃ me sutaṃ’, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
The word "by me" is seen in three senses. Likewise, of it – in such instances as "What is sung in verse is not to be eaten by me," the meaning is "by me." In such instances as "It would be good, venerable sir, if the Blessed One would teach me the Dhamma in brief," the meaning is "to me." In such instances as "Monks, become heirs of the Dhamma to me," the meaning is "of me." Here, however, it fits in both senses: "by me it was heard" and "of me it was heard."
Từ "Me" được thấy trong ba nghĩa. Như trong câu "Gāthābhigītaṃ me abhojaneyya" (Ta không nên thọ dụng những gì được ca ngợi bằng kệ tụng), v.v..., nó có nghĩa là "mayā" (bởi tôi). Trong câu "Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetu" (Lành thay, bạch Thế Tôn, xin Thế Tôn thuyết pháp tóm tắt cho con), v.v..., nó có nghĩa là "mayhaṃ" (cho tôi). Trong câu "Dhammadāyādā me, bhikkhave, bhavathā" (Này các Tỳ-kheo, hãy là người thừa tự Pháp của ta), v.v..., nó có nghĩa là "mama" (của tôi). Tuy nhiên, ở đây, nó phù hợp với cả hai nghĩa: "mayā sutaṃ" (được nghe bởi tôi) và "mama sutaṃ" (sự nghe của tôi).
Me-saddo tīsu atthesu dissati. Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho. ‘‘Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88) mayhanti attho. ‘‘Dhammadāyādā me, bhikkhave , bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho. Idha pana mayā sutanti ca, mama sutanti ca atthadvaye yujjati.
"Heard," this word "heard," both with a prefix and without a prefix, has a variety of meanings: going, renowned, moist, accumulated, devoted, to be known by the ear, known through the ear-door, and so on. Likewise, in such instances as, "gone forth with the army," the meaning is "going." In such instances as, "For one who sees the heard Dhamma," the meaning is "of the renowned Dhamma." In such instances as, "Moist with what is moist," the meaning is "moistened with what is moistened." In such instances as, "By you, merit has been accumulated, not a little," the meaning is "accumulated." In such instances as, "Those wise ones devoted to jhāna," the meaning is "devoted to jhāna." In such instances as, "Seen, heard, sensed," the meaning is "to be known by the ear." In such instances as, "A bearer of what is heard, an accumulator of what is heard," the meaning is "one who has known the Dhamma through the ear-door." Here, however, its meaning is "apprehended through the ear-door" or "apprehension." For, when the word 'by me' has the meaning 'by me,' 'thus by me it was heard,' it is fittingly 'apprehended through the ear-door.' When it has the meaning 'of me,' 'thus of me it was heard,' it is fittingly 'apprehension through the ear-door.'
Từ "Sutaṃ" (được nghe) này, dù có giới từ hay không có giới từ, có nhiều nghĩa khác nhau như đi, nổi tiếng, thấm ướt, tích lũy, chuyên cần, đối tượng của thức ở tai, được biết đến theo con đường ở tai, được hiểu, v.v... Như trong câu "Senāya pasuto" (bị quân đội áp đảo), v.v..., nó có nghĩa là "gacchanto" (đi). Trong câu "Sutadhammassa passato" (với người thấy Pháp đã được nghe), v.v..., nó có nghĩa là "vissutadhammassa" (với người có Pháp nổi tiếng). Trong câu "Avassutā avassutassā" (bị thấm ướt bởi người bị thấm ướt), v.v..., nó có nghĩa là "kilinnākilinnassā" (với người bị ướt và không bị ướt). Trong câu "Tumhehi puññaṃ pasutaṃ anappaka" (Các người đã tích lũy được công đức không nhỏ), v.v..., nó có nghĩa là "upacitaṃ" (được tích lũy). Trong câu "Ye jhānapasutā dhīrā" (Những người trí chuyên cần thiền), v.v..., nó có nghĩa là "jhānānuyuttā" (chuyên cần thiền). Trong câu ‘Diṭṭhaṃ sutaṃ muta’ (được thấy, được nghe, được nhận thức), v.v..., nó có nghĩa là "sotaviññeyyaṃ" (đối tượng của thức ở tai). Trong câu "Sutadharo sutasannicayo" (người trì giữ những gì đã nghe, người tích lũy những gì đã nghe), v.v..., nó có nghĩa là "sotadvārānusāraviññātadharoti" (người trì giữ những gì được biết theo con đường ở tai). Tuy nhiên, ở đây, nó có nghĩa là "upadhāritaṃ" (được ghi nhớ) theo con đường ở tai, hoặc "upadhāraṇaṃ" (sự ghi nhớ). Vì khi từ "me" có nghĩa là "mayā" (bởi tôi), thì "evaṃ mayā sutaṃ" (tôi nghe như vầy) có nghĩa là "được ghi nhớ theo con đường ở tai". Khi nó có nghĩa là "mama" (của tôi), thì "evaṃ mama sutaṃ" (tôi nghe như vầy) có nghĩa là "sự ghi nhớ theo con đường ở tai".
Sutanti ayaṃ suta-saddo saupasaggo ca anupasaggo ca – gamanavissutakilinna-upacitānuyoga-sotaviññeyya-sotadvārānusāra-viññātādianekatthappabhedo, tathā hissa ‘‘senāya pasuto’’tiādīsu gacchantoti attho. ‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho. ‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho. ‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho. ‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho. ‘Diṭṭhaṃ sutaṃ muta’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho. ‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho. Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vāti attho. ‘Me’ saddassa hi ‘mayā’ti atthe sati ‘evaṃ mayā sutaṃ’ sotadvārānusārena upadhāritanti yujjati. ‘Mamā’ti atthe sati evaṃ mama sutaṃ sotadvārānusārena upadhāraṇanti yujjati.
Thus, in these three words, "thus" is the indication of the function of cognition, such as ear-consciousness. "By me" is the indication of the person possessing the aforementioned cognition. "Heard" is the indication of the unimpaired, complete, and undistorted grasping, due to the rejection of the state of non-hearing. Likewise, "thus" is the illumination of the state of occurrence in the object, in various ways, of that stream of consciousness arisen through the ear-door. "By me" is the declaration of oneself. "Heard" is the declaration of the Dhamma. This is the summary here: "By me, with the stream of consciousness arisen in the object in various ways, nothing else was done; but this was done, this Dhamma was heard."
Như vậy, trong ba từ này, "Evaṃ" (như vầy) là sự mô tả chức năng của thức ở tai, v.v... "Me" (tôi) là sự mô tả người có thức được đề cập. "Sutaṃ" (được nghe) là sự mô tả sự nắm bắt không thiếu, không thừa, không trái ngược, từ sự loại trừ trạng thái nghe suông. Như vậy, "Evaṃ" (như vầy) là sự trình bày trạng thái của dòng thức ấy, vận hành theo con đường ở tai, đối với đối tượng theo nhiều cách khác nhau. "Me" (tôi) là sự trình bày về tự thân. "Sutaṃ" (được nghe) là sự trình bày về Pháp. Ở đây, đây là bản tóm tắt: "Với dòng thức vận hành theo nhiều cách khác nhau đối với đối tượng, tôi không làm gì khác, mà chỉ làm điều này, Pháp này được nghe."
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ. Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ. Sutanti assavanabhāvapaṭikkhepato anūnādhikāviparītaggahaṇanidassanaṃ. Tathā evanti tassā sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ. Meti attappakāsanaṃ. Sutanti dhammappakāsanaṃ. Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
Likewise, "thus" is the declaration of the Dhamma to be indicated. "By me" is the declaration of the person. "Heard" is the declaration of the person's activity. This is what is said: "The sutta that I will indicate, that was heard by me thus."
Như vậy, "Evaṃ" (như vầy) là sự trình bày Pháp cần được chỉ ra. "Me" (tôi) là sự trình bày về người. "Sutaṃ" (được nghe) là sự trình bày về công việc của người. Điều này được nói đến: "Bài kinh mà tôi sẽ chỉ ra, đã được tôi nghe như vầy."
Tathā evanti niddisitabbadhammappakāsanaṃ. Meti puggalappakāsanaṃ. Sutanti puggalakiccappakāsanaṃ. Idaṃ vuttaṃ hoti. ‘‘Yaṃ suttaṃ niddisissāmi, taṃ mayā evaṃ suta’’nti.
Likewise, "thus" is the designation of the various aspects of the continuum of consciousness, by the various arising of which the grasping of various meanings and expressions occurs. For "thus" is this designation of manner. "By me" is the designation of the doer. "Heard" is the designation of the object. By this much, the establishment of the grasping of the object by the doer who possesses that continuum of consciousness arisen in various ways is done.
Như vậy, "Evaṃ" (như vầy) là sự mô tả nhiều cách của dòng tâm thức của người nắm bắt được nhiều ý nghĩa và văn tự khác nhau bằng sự vận hành theo nhiều cách khác nhau. "Evaṃ" ở đây là sự trình bày về cách thức. "Me" (tôi) là sự mô tả về chủ thể. "Sutaṃ" (được nghe) là sự mô tả về đối tượng. Nhờ đó, sự xác định về sự nắm bắt đối tượng của chủ thể có dòng tâm thức vận hành theo nhiều cách được thực hiện.
Tathā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso. Evanti hi ayamākārapaññatti. Meti kattuniddeso. Sutanti visayaniddeso. Ettāvatā nānākārappavattena cittasantānena taṃ samaṅgino kattu visayaggahaṇasanniṭṭhānaṃ kataṃ hoti.
Or, "thus" is the designation of the person's activity. "Heard" is the designation of the activity of cognition. "By me" is the designation of the person conjoined with both activities. The summary here is this: "By me, the person possessing the activity of hearing and cognition, with the designation of the activity of hearing gained through cognition, it was heard."
Hoặc, "Evaṃ" (như vầy) là sự mô tả về công việc của người. "Sutaṃ" (được nghe) là sự mô tả về chức năng của thức. "Me" (tôi) là sự mô tả về người có cả hai công việc. Ở đây, đây là bản tóm tắt: "Với người có công việc nghe và thức, nhờ có danh hiệu công việc nghe được có được nhờ thức, đã nghe."
Athavā evanti puggalakiccaniddeso. Sutanti viññāṇakiccaniddeso. Meti ubhayakiccayuttapuggalaniddeso. Ayaṃ panettha saṅkhepo, ‘‘mayā savanakiccaviññāṇasamaṅginā puggalena viññāṇavasena laddhasavanakiccavohārena suta’’nti.
Herein, both "thus" and "by me" are designations that do not exist according to the ultimate reality of the real. What is there here, in the ultimate sense, that would receive the designation "thus" or "by me"? "Heard" is a designation that exists. For what was apprehended here by the ear, that exists in the ultimate sense. Likewise, both 'thus' and 'by me' are collective designations, because they are to be spoken with reference to this and that. 'Heard' is a referential designation, because it is to be spoken with reference to things seen and so on. And here, by the word "thus," he illuminates non-delusion. For one who is deluded is not capable of penetrating various aspects. By the word "heard," he illuminates the non-confusion of what was heard. For he whose hearing is confused does not, at a later time, acknowledge, "This was heard by me." Thus, by his non-delusion, the accomplishment of wisdom; by his non-confusion, the accomplishment of mindfulness. Herein, by mindfulness preceded by wisdom, the ability to determine the phrasing; by wisdom preceded by mindfulness, the ability to penetrate the meaning. By the conjunction of the ability of both, the accomplishment of being a treasurer of the Dhamma, due to the ability to preserve the treasure of the Dhamma, endowed with meaning and phrasing.
Ở đây, "Evaṃ" (như vầy) và "Me" (tôi) là những khái niệm không có thực theo nghĩa chân đế tuyệt đối (sự thật tối hậu). Ở đây, có gì thực sự tồn tại theo nghĩa chân đế, mà có thể được mô tả là "Evaṃ" (như vầy) hay "Me" (tôi)? "Sutaṃ" (được nghe) là một khái niệm có thực. Vì những gì được nhận biết ở đây bằng tai, là có thực theo nghĩa chân đế. Như vậy, "Evaṃ" (như vầy) và "Me" (tôi), vì được nói đến dựa trên cái này cái kia, là khái niệm dựa trên sự nương tựa (upādāpaññatti). "Sutaṃ" (được nghe), vì được nói đến dựa trên sự thấy, v.v..., là khái niệm dựa trên sự đặt để (upanidhāpaññatti). Và ở đây, với từ "Evaṃ" (như vầy), ngài làm sáng tỏ sự không mê mờ. Vì người mê mờ không thể thấu hiểu theo nhiều cách khác nhau. Với từ "Sutaṃ" (được nghe), ngài làm sáng tỏ sự không lẫn lộn của những gì đã nghe. Vì người có những gì đã nghe bị lẫn lộn, không thể thừa nhận sau này rằng "đã được nghe bởi tôi". Như vậy, với sự không mê mờ, trí tuệ được thành tựu, với sự không lẫn lộn, niệm được thành tựu. Ở đây, với niệm đi trước, trí tuệ có khả năng ghi nhớ văn tự, với trí tuệ đi trước, niệm có khả năng thấu hiểu ý nghĩa. Với sự kết hợp khả năng của cả hai, sự thành tựu của kho tàng Pháp, kho chứa Pháp đầy đủ ý nghĩa và văn tự, được bảo vệ.
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti. Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha? Sutanti vijjamānapaññatti. Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti. Tathā ‘eva’nti ca, meti ca, taṃ taṃ upādāya vattabbato upādāpaññatti. ‘Suta’nti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti. Ettha ca evanti vacanena asammohaṃ dīpeti. Na hi sammūḷho nānappakārapaṭivedhasamattho hoti. ‘Suta’nti vacanena sutassa asammosaṃ dīpeti. Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti. Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi. Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā. Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
Another method: with the word "thus" he indicates careful attention, because of the absence of various kinds of penetration for one who attends carelessly. With the word "heard," he indicates non-distraction, because of the absence of hearing for one whose mind is distracted. For a distracted person, even when being told of complete success, says, "I did not hear it, please say it again." Herein, by careful attention, he accomplishes right self-application and previous meritorious deeds, because of their absence for one who is wrongly self-applied or who has not done meritorious deeds previously. By non-distraction, he accomplishes listening to the true teaching and association with superior persons. For one with a distracted mind cannot listen, and there is no listening for one who is not associating with superior persons.
Một cách giải thích khác, "evaṃ" (như vầy), câu nói này trình bày sự chú tâm đúng đắn (như lý tác ý). Bởi vì người chú tâm không đúng đắn thì không thể thâm nhập (thể nhập, chứng ngộ) nhiều phương diện khác nhau. "Sutaṃ" (đã nghe), câu nói này trình bày sự không tán loạn, vì người có tâm tán loạn thì không thể nghe. Thật vậy, người có tâm tán loạn, dù cho được nói với tất cả sự đầy đủ, cũng nói rằng: "Tôi chưa nghe, xin hãy nói lại". Ở đây, với sự chú tâm đúng đắn, Ngài làm cho (người nghe) hiểu rõ sự đặt mình đúng đắn (thân, khẩu, ý) và công đức đã tạo trong quá khứ, vì người không đặt mình đúng đắn hoặc không có công đức đã tạo trong quá khứ thì không có sự chú tâm đúng đắn. Với sự không tán loạn, Ngài làm cho (người nghe) hiểu rõ sự nghe diệu pháp và sự nương tựa bậc thiện trí thức. Vì người có tâm tán loạn thì không thể nghe, và người không nương tựa bậc thiện trí thức thì không có sự nghe.
Aparo nayo, evanti vacanena yoniso manasikāraṃ dīpeti. Ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato. Sutanti vacanena avikkhepaṃ dīpeti, vikkhittacittassa savanābhāvato. Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati. Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato. Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti. Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthīti.
Another method: since for one whose mind has, by various means of arising, the grasping of diverse meanings and expressions, he said, "exposition by various means," it is said, "thus" for such a wholesome condition does not exist for one who has not applied himself rightly or for the one who has not done meritorious deeds previously. Therefore, by means of this wholesome condition, "thus," he indicates only one who has the complete accomplishment of the two latter wheels. "Heard", by means of the suitability of hearing indicates one who has the complete accomplishment of the two former wheels. For there is no hearing for one who dwells in an unsuitable place or for one devoid of association with superior persons. Thus, by the accomplishment of the two latter wheels, the purification of intention is accomplished, and by the accomplishment of the two former wheels, the purification of application. And by that purification of intention, the clarity of attainment is accomplished; by the purification of application, the clarity of learning is accomplished. Therefore, the words of one whose application and intention are purified, and who is accomplished in learning and attainment, are like the dawn before the rising of the sun, or like careful attention before wholesome action, is worthy to be the prelude of the Blessed One's word; placing the setting in the right place, he said: "Thus have I heard".
Một cách giải thích khác, vì "evaṃ" (như vầy) chỉ cho sự nắm bắt nghĩa và văn (văn tự, chữ nghĩa) khác nhau do sự vận hành (lưu chuyển) khác nhau của dòng tâm thức (tâm sở tương ưng) của người đó, nên nói là chỉ bày các phương diện khác nhau, và trạng thái (hình thức, phương cách) tốt đẹp như vậy không có ở người không đặt mình đúng đắn hoặc không có công đức đã tạo trong quá khứ, cho nên "evaṃ" (như vầy), với trạng thái tốt đẹp này, Ngài chỉ bày sự đầy đủ của hai bánh xe sau (chỉ cho hai yếu tố cuối trong bốn yếu tố đưa đến an lạc: trú xứ thích hợp, gần gũi bậc thiện trí thức, tự đặt mình vào chính đạo, đã tạo công đức trong quá khứ) của người đó. "Sutaṃ" (đã nghe) với sự có thể nghe, chỉ bày sự đầy đủ của hai bánh xe trước (chỉ cho hai yếu tố đầu trong bốn yếu tố). Vì người không sống ở trú xứ thích hợp hoặc thiếu sự nương tựa bậc thiện trí thức thì không có sự nghe. Như vậy, với sự thành tựu hai bánh xe sau, sự thanh tịnh của ý hướng (thái độ, nguyện vọng) được thành tựu, với sự thành tựu hai bánh xe trước, sự thanh tịnh của hành động (hành vi, nỗ lực) được thành tựu, và với sự thanh tịnh của ý hướng đó, sự thành tựu về thể nhập rõ ràng (chứng ngộ) được thành tựu, với sự thanh tịnh của hành động, sự thành tựu về lãnh hội rõ ràng (học hỏi) được thành tựu. Như vậy, lời nói của người có sự thanh tịnh về hành động và ý hướng, có sự thành tựu về lãnh hội và thể nhập, giống như ánh bình minh của mặt trời, xứng đáng đi trước lời của Đức Thế Tôn, giống như sự chú tâm đúng đắn của nghiệp lành, làm nền tảng (duyên khởi, cơ sở), Ngài nói "evaṃ me sutaṃ" (như vầy tôi nghe), v.v...
Aparo nayo, yasmā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddesoti vuttaṃ, so ca evaṃ bhaddako ākāro na sammāappaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakenākārena pacchimacakkadvayasampattimattano dīpeti. Sutanti savanayogena purimacakkadvayasampattiṃ. Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi. Iccassa pacchimacakkadvayasiddhiyā āsayasuddhisiddhā hoti, purimacakkadvayasiddhiyā payogasuddhi, tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi. Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato yoniso manasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento – ‘‘evaṃ me suta’’ntiādimāha.
Another method: By this word, 'Thus', which indicates various modes of understanding, he shows the existence of his own accomplishment in the analytical knowledge of meaning and understanding. By the word 'Heard', which indicates understanding of the variety to be heard, he shows the existence of his accomplishment in the analytical knowledge of the Dhamma and its definition. And uttering the word 'Thus', which indicates careful attention, he reveals: "These teachings have been examined by me with the mind, well penetrated by insight." Uttering the word 'Heard', which indicates the suitability of hearing, he reveals: "Many teachings have been heard by me, held, and practiced verbally." By both of these, indicating the fullness of meaning and expression, he generates respect in hearing. For one who does not listen with respect to the teaching which is complete in meaning and expression, is deprived of great benefit. Therefore, generating respect, this teaching should be listened to attentively.
Một cách giải thích khác, 'evaṃ' (như vầy), với câu nói chỉ bày sự thâm nhập nhiều phương diện khác nhau này, Ngài chỉ bày sự hiện hữu của sự thành tựu về nghĩa vô ngại giải và biện tài vô ngại giải của chính mình. 'Sutaṃ' (đã nghe), với câu nói chỉ bày sự thâm nhập các loại cần phải nghe này, Ngài chỉ bày sự hiện hữu của sự thành tựu về pháp vô ngại giải và từ vô ngại giải. 'Evaṃ' (như vầy), nói câu nói chỉ bày sự chú tâm đúng đắn này, Ngài chỉ bày "Những pháp này đã được tôi quán sát bằng ý, đã được thâm nhập rõ ràng bằng trí tuệ". 'Sutaṃ' (đã nghe), nói câu nói chỉ bày sự có thể nghe này, Ngài chỉ bày "Nhiều pháp đã được tôi nghe, đã được ghi nhớ, đã được quen thuộc bằng lời". Với cả hai điều đó, Ngài chỉ bày sự đầy đủ về nghĩa và văn, làm phát sinh sự tôn kính trong việc nghe. Vì người không tôn kính nghe pháp đầy đủ về nghĩa và văn thì sẽ mất đi lợi ích lớn, cho nên sau khi làm phát sinh sự tôn kính, (Ngài dạy rằng) pháp này cần phải được nghe một cách cung kính.
Aparo nayo, ‘eva’nti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti. ‘Suta’nti iminā sotabbappabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ. ‘Eva’nti ca idaṃ yoniso manasikāradīpakaṃ vacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā, diṭṭhiyā suppaṭividdhā’’ti dīpeti. ‘Suta’nti idaṃ savanayogadīpakaṃ vacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti. Tadubhayenāpi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti. Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti, tasmā ādaraṃ janetvā sakkaccaṃ ayaṃ dhammo sotabboti.
But by this whole phrase, "Thus have I heard", the venerable Ānanda, not appropriating the Dhamma proclaimed by the Tathāgata, transcends the state of an inferior person. Acknowledging his status as a disciple, he enters the state of a superior person. Thus, he turns his mind away from false teachings and establishes his mind in the true teaching. Indicating, "This is only what I have heard, it is the word of that Blessed One alone", he frees himself, he points to the Teacher, he transmits the word of the Victor, he establishes the lineage of the teaching.
Nhưng với toàn bộ câu "evaṃ me sutaṃ" (như vầy tôi nghe) này, Tôn giả Ānanda vượt qua địa vị phàm phu (kẻ chưa giác ngộ), không chấp giữ (thủ trước, bám víu) pháp do Đức Như Lai tuyên thuyết là của mình. Ngài bước vào địa vị Thánh nhân, tuyên bố mình là đệ tử. Như vậy, Ngài tách tâm ra khỏi pháp bất thiện, thiết lập tâm trong thiện pháp. Ngài chỉ bày "Đây chỉ là điều tôi đã nghe, là lời của chính Đức Thế Tôn kia", giải thoát cho mình, quy y (nương tựa) Đức Đạo Sư, hướng về lời Phật dạy, thiết lập con đường pháp (pháp nhãn, phương pháp tu tập).
‘‘Evaṃ me suta’’nti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati. Sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati. Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti. ‘‘Kevalaṃ sutamevetaṃ mayā, tasseva bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
Moreover, not claiming, by saying "Thus have I heard", that it was produced by himself, clarifying the previous statement: "This was received by me in the presence of that Blessed One, who is confident with the four confidences, who possesses the ten powers, who stands in the foremost position, who roars the lion's roar, who is the supreme of all beings, the Lord of the Dhamma, the King of the Dhamma, the Master of the Dhamma, the Light of the Dhamma, the Refuge of the Dhamma, the Supreme Wheel-Turner of the true Dhamma, the Perfectly Enlightened One; there should be no doubt or uncertainty regarding the meaning, the Dhamma, the words, or the expressions." For all gods and humans, he removes disbelief in this teaching, and he generates the accomplishment of faith. Therefore, it is said:
Hơn nữa, "evaṃ me sutaṃ" (như vầy tôi nghe), không tuyên bố là do mình tạo ra, giải thích câu nói trước, "Đây là điều tôi đã trực tiếp (tận mặt, trước mặt) nhận lãnh từ Đức Thế Tôn kia, bậc có bốn vô sở úy (bốn điều không sợ hãi), bậc có mười lực, bậc đứng vững ở địa vị tối thượng, bậc rống tiếng rống sư tử, bậc tối thượng của tất cả chúng sinh, bậc Pháp chủ, bậc Pháp vương, bậc Pháp chủ tể, bậc ngọn đèn pháp, bậc nương tựa pháp, bậc Chuyển luân Thánh vương của diệu pháp, bậc Toàn Giác, không có sự nghi ngờ hoặc phân vân nào cần phải làm trong nghĩa, trong pháp, trong cú, hoặc trong văn của pháp này", Ngài dẹp tan sự không tin trong pháp này của tất cả chư thiên và loài người, làm phát sinh sự thành tựu về lòng tin. Cho nên điều này được nói là:
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto – ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kātabbā’’ti sabbesaṃ devamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādeti. Tenetaṃ vuccati –
"He destroys disbelief, he increases faith in the Dispensation;
"Dẹp tan sự không tin, tăng trưởng lòng tin trong giáo pháp;
‘‘Vināsayati assaddhaṃ, saddhaṃ vaḍḍheti sāsane;
Thus, saying 'Thus have I heard,' the disciple of Gotama."
Như vậy tôi nghe, như vầy, nói, đệ tử của Gotama (Cồ-đàm)."
Evaṃ me sutamiccevaṃ, vadaṃ gotamasāvako’’ti.
"At one" is a designation specifying enumeration. "Time" is a designation of limitation. "At one time" indicates an unfixed definition. Here, the word "time" --
"Ekaṃ" (một) là sự xác định đếm số. "Samayaṃ" (thời) là sự xác định có giới hạn. "Ekaṃ samayaṃ" (một thời) là sự trình bày không xác định. Ở đây, từ "samaya" (thời) –
Ekanti gaṇanaparicchedaniddeso. Samayanti paricchinnaniddeso. Ekaṃ samayanti aniyamitaparidīpanaṃ. Tattha samayasaddo –
"In conjunction, in moment, in season, in multitude, in reason and view;
"Trong tập hợp, trong sát-na, trong thời gian, trong hội chúng, trong nhân và tà kiến;
‘‘Samavāye khaṇe kāle, samūhe hetudiṭṭhisu;
In attainment, in abandonment, and in penetration is seen."
Trong sự đạt được, trong sự đoạn tận, và trong sự thâm nhập được thấy".
Paṭilābhe pahāne ca, paṭivedhe ca dissati’’.
Thus, its -- "If we could approach both at the appropriate time and occasion" in such passages as these, the meaning is conjunction. "Only one, monks, is the moment and the time for living the holy life" in such passages as these, the meaning is moment. "Hot season, season of heat" in such passages as these, the meaning is season. "A great gathering in the forest" in such passages as these, the meaning is multitude. "Even the time, Bhaddāli, was not understood by you, the Blessed One dwells at Sāvatthī, the Blessed One will know me, 'The monk Bhaddāli does not fulfill the training in the Teacher's Dispensation'. Even this, Bhaddāli, was a time not understood by you" in such passages as these, the meaning is reason. "At that time, the wanderer Uggahamāna, son of Samaṇamuṇḍikā, was dwelling in the Tinduka-shaded Mallikā's park, a place for debates about views" in such passages as these, the meaning is view.
Như vậy, nghĩa của nó là – "Nếu có thể, chúng ta cũng sẽ đến vào ngày mai, tùy theo thời gian và thời" trong các câu như vậy (Dī. Ni. 1.447) là tập hợp. "Này các Tỳ-kheo, chỉ có một sát-na và thời để sống đời phạm hạnh" trong các câu như vậy (A. Ni. 8.29) là sát-na. "Thời nóng bức, thời oi bức" trong các câu như vậy (Pāci. 358) là thời gian. "Trong khu rừng lớn có đại hội" trong các câu như vậy (Dī. Ni. 2.332) là hội chúng. "Này Bhaddāli, ngươi đã không thâm nhập thời, Đức Thế Tôn đang trú ở Sāvatthi, Đức Thế Tôn cũng sẽ biết ta, 'Tỳ-kheo tên Bhaddāli không làm cho đầy đủ sự tu học trong giáo pháp của bậc Đạo Sư'. Này Bhaddāli, đây cũng là thời ngươi đã không thâm nhập" trong các câu như vậy (Ma. Ni. 2.135) là nhân. "Vào thời đó, du sĩ Uggahamāna, con trai của Samaṇamuṇḍikā (Sa-môn Thích tử), trú tại vườn Mallikā (Mạt-lợi) có một căn nhà lá, trong rừng cây Tinduka (Thiên-điện), nơi tranh luận của các học phái" trong các câu như vậy (Ma. Ni. 2.260) là tà kiến.
Tathā hissa – ‘‘appevanāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho. ‘‘Ekova kho bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo. ‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo. ‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho. ‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati, bhaddāli nāma bhikkhu satthusāsane sikkhāya aparipūrakārī’ti. Ayampi kho, te bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu. ‘‘Tena kho pana samayena uggahamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
"The good that is in the seen Dhamma, and the good that is in the future life;
"Trong đời này có lợi ích, và lợi ích cho đời sau;
‘‘Diṭṭhe dhamme ca yo attho, yo cattho samparāyiko;
By attainment of good the wise, is called a sage."
Do thâm nhập lợi ích, bậc trí, được gọi là người có trí". (Saṃ. Ni. 1.128) –
Atthābhisamayā dhīro, paṇḍitoti pavuccatī’’ti. (saṃ. ni. 1.128) –
In such passages as these, the meaning is attainment. "Through complete penetration of conceit, he made an end of suffering" in such passages as these, the meaning is abandonment. "The meaning of suffering is affliction, the meaning of conditioning, the meaning of heat, the meaning of change, and the meaning of penetration" in such passages as these, the meaning is penetration. Here, however, its meaning is season. He indicates, "at one time", among these times such as year, season, month, half-month, night, day, forenoon, midday, afternoon, the first watch, the middle watch, and the last watch of the night, moments and so on, which are the divisions of time.
Trong các câu như vậy là sự đạt được. "Do thâm nhập hoàn toàn mạn, chấm dứt khổ đau" trong các câu như vậy (A. Ni. 7.9) là sự đoạn tận. "Nghĩa bức bách, nghĩa được cấu tạo, nghĩa thiêu đốt, nghĩa biến đổi, nghĩa thâm nhập của khổ" trong các câu như vậy (Paṭi. 108) là sự thâm nhập. Nhưng ở đây, nghĩa của nó là thời gian. Như vậy, Ngài chỉ bày "ekaṃ samayaṃ" (một thời) trong các loại thời gian như năm, mùa, tháng, nửa tháng, ban đêm, ban ngày, buổi sáng, giữa trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v...
Ādīsu paṭilābho. ‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (a. ni. 7.9) pahānaṃ. ‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. 108) paṭivedho. Idha panassa kālo attho. Tena saṃvaccharautumāsaḍḍhamāsarattidivapubbaṇhamajjhanhikasāyanhapaṭhamamajjhi-mapacchimayāmamuhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Although among all these times such as year and so forth, whatever discourse was spoken in whichever year, season, month, fortnight, part of the night, or part of the day, all that was well-known, well-established in knowledge by the elder. Yet because -- if it were said, "Thus have I heard, in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a part of the night, in such and such a part of the day", it would not be possible to easily remember, recite, or cause to be recited, and there would be much to be said, therefore, collecting that meaning with only one word, he said, "at one time". Or there are these diverse times of the Blessed One, exceedingly well-known among gods and humans, such as the time of conception, the time of birth, the time of stirring, the time of renunciation, the time of practicing austerities, the time of conquering Māra, the time of enlightenment, the time of dwelling in the happiness of the seen Dhamma, the time of teaching, and the time of final Nibbāna. Among these times, he indicates "one time", referring to the occasion of teaching. And this is the time of the task of compassion among the tasks of knowledge and compassion, the time of practicing for the welfare of others among the times of practicing for one's own welfare and the welfare of others, the time of discourse on the Dhamma among the two tasks to be done for those who have assembled, the time of teaching among the times of practicing teaching; referring to one time among these times, he said, "at one time".
Ở đây, mặc dù tất cả các bài kinh, trong các thời gian như năm, v.v..., bài kinh nào được nói vào năm nào, mùa nào, tháng nào, nửa tháng nào, phần ban đêm nào, phần ban ngày nào, tất cả đều được Tôn giả biết rõ, được xác định rõ ràng bằng trí tuệ. Nhưng vì – nếu nói "evaṃ me sutaṃ" (như vầy tôi nghe) vào năm đó, vào mùa đó, vào tháng đó, vào nửa tháng đó, vào phần ban đêm đó, vào phần ban ngày đó, thì không thể dễ dàng ghi nhớ, hoặc tụng đọc, hoặc bảo người khác tụng đọc, và có nhiều điều phải nói, cho nên sau khi bao gồm ý nghĩa đó bằng một từ, Ngài nói "ekaṃ samayaṃ" (một thời). Hoặc những thời như thời vào thai, thời sinh, thời chấn động, thời xuất gia, thời tu khổ hạnh, thời chiến thắng Māra (Ma vương), thời giác ngộ, thời trú lạc trong hiện tại, thời thuyết pháp, thời Niết-bàn, v.v..., những thời như vậy của Đức Thế Tôn được biểu hiện rõ ràng trong chư thiên và loài người, là những thời có sự phân chia thời gian khác nhau. Trong những thời đó, Ngài chỉ bày "ekaṃ samayaṃ" (một thời) là thời thuyết pháp. Và trong các thời như thời có nhiệm vụ về trí tuệ và từ bi, thời này là thời có nhiệm vụ về từ bi, trong các thời có nhiệm vụ về lợi mình và lợi người, đây là thời có nhiệm vụ về lợi người, trong các thời có hai việc cần làm của những người đã tập hợp, đây là thời có câu chuyện về pháp, trong các thời có nhiệm vụ về thuyết pháp, đây là thời thuyết pháp, Ngài nói "ekaṃ samayaṃ" (một thời) bao hàm một thời nào đó trong những thời đó.
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge vā divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya. Yasmā pana – ‘‘evaṃ me sutaṃ’’ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vāti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha. Ye vā ime gabbhokkantisamayo, jātisamayo, saṃvegasamayo, abhinikkhamanasamayo, dukkarakārikasamayo, māravijayasamayo, abhisambodhisamayo diṭṭhadhammasukhavihārasamayo, desanāsamayo, parinibbānasamayoti, evamādayo bhagavato devamanussesu ativiya pakāsā anekakālappabhedā eva samayā. Tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti. Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ samayaṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
Why, here, as in the Abhidhamma, "at the time when it is sense-sphere" and in other sutta passages, "at the time, monks, when a monk is secluded from sensual pleasures" the locative case designation is made, and in the Vinaya, "at that time the Buddha, the Blessed One" with the instrumental case, without doing so, is the designation of the accusative case made as "at one time"? Here and there, the different possibilities of meaning exist. For there, in the Abhidhamma and in other sutta passages, the meaning of location and the meaning of condition is possible. The time meaning and the multitude meaning are the location, and by the time consisting of moment, conjunction, and reason, of those contact and other dhammas spoken of there, their condition is indicated; therefore, to indicate that meaning, the locative case designation is made there.
Vì sao ở đây, không giống như trong Abhidhamma (A-tỳ-đàm) "yasmiṃ samaye kāmāvacaraṃ" (trong thời dục giới) (Dha. Sa. 1), và trong các đoạn kinh khác – "yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī" (trong thời, này các Tỳ-kheo, vị Tỳ-kheo ly dục), v.v..., được chỉ định bằng sở thuộc cách (bhummavacana), và trong Luật – "tena samayena buddho bhagavā" (vào thời đó, Đức Phật Thế Tôn), v.v..., được chỉ định bằng công cụ cách (karaṇavacana), mà lại chỉ định bằng sử dụng cách (upayogavacana) "ekaṃ samayaṃ" (một thời)? Ở đây, vì sự có thể có ý nghĩa khác nhau ở đó và ở đây. Vì ở đó, trong Abhidhamma (A-tỳ-đàm) và trong các đoạn kinh khác, có thể có ý nghĩa vị trí (ādhikaraṇattha) và ý nghĩa biểu thị trạng thái bằng trạng thái. Vì thời gian và hội chúng là ý nghĩa vị trí của thời, trạng thái của các pháp xúc, v.v..., được nói ở đó, được biểu thị bằng trạng thái của thời là sát-na, tập hợp và nhân, cho nên để làm sáng tỏ ý nghĩa đó, ở đó được chỉ định bằng sở thuộc cách.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti (dha. sa. 1) ca, ito aññesu ca suttapadesu – ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacananiddeso kato, vinaye ca – ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacananiddeso katoti? Tattha tathā idha ca aññathā atthasambhavato. Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvena bhāvalakkhaṇattho ca sambhavati. Adhikaraṇañhi kālattho, samūhattho ca samayo, tattha tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati, tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
And in the Vinaya, the meaning of reason and the meaning of instrument is possible. For that time of formulating the training rules, which is difficult to understand even by Sāriputta and others, by that time which is the reason and the instrument, formulating the training rules, and awaiting the reason for formulating the training rules, the Blessed One dwelled here and there; therefore, to indicate that meaning, the designation with the instrumental case is made there.
Và trong Luật, có thể có ý nghĩa nhân và ý nghĩa công cụ. Vì thời mà giới điều được ban hành, ngay cả Sāriputta (Xá-lợi-phất), v.v..., cũng khó biết, với thời đó là nhân và là công cụ, Đức Thế Tôn ban hành các giới điều, và mong đợi nhân ban hành giới điều, Ngài trú ở đó, cho nên để làm sáng tỏ ý nghĩa đó, ở đó được chỉ định bằng công cụ cách.
Vinaye ca hetuattho karaṇattho ca sambhavati. Yo hi so sikkhāpadapaññattisamayo sāriputtādīhipi dubbiññeyyo, tena samayena hetubhūtena karaṇabhūtena ca sikkhāpadāni paññāpayanto sikkhāpadapaññattihetuñca apekkhamāno bhagavā tattha tattha vihāsi, tasmā tadatthajotanatthaṃ tattha karaṇavacanena niddeso kato.
But here and in similar instances, the meaning of continuous connection is possible. For whatever time the Blessed One taught this or another discourse, he continuously dwelled in the abiding of compassion during that time; therefore, to indicate that meaning, here the designation of the accusative case is made.
Nhưng ở đây và trong các trường hợp tương tự khác, có thể có ý nghĩa liên tục tuyệt đối. Vì thời mà Đức Thế Tôn thuyết bài kinh này hoặc bài kinh khác, Ngài đã trú với sự trú từ bi liên tục trong thời đó, cho nên để làm sáng tỏ ý nghĩa đó, ở đây được chỉ định bằng sử dụng cách.
Idha pana aññasmiñca evaṃ jātike accantasaṃyogattho sambhavati. Yañhi samayaṃ bhagavā imaṃ aññaṃ vā suttantaṃ desesi, accantameva taṃ samayaṃ karuṇāvihārena vihāsi, tasmā tadatthajotanatthaṃ idha upayogavacananiddeso katoti.
Therefore, it is said --
Cho nên điều này được nói là:
Tenetaṃ vuccati –
"Considering that particular meaning, with the locative and the instrumental;
"Mong đợi ý nghĩa đó, bằng sở thuộc và bằng công cụ;
‘‘Taṃ taṃ atthamapekkhitvā, bhummena karaṇena ca;
Elsewhere time is spoken, with the accusative it is here."
Ở nơi khác, thời được nói, bằng sử dụng, nó ở đây".
Aññatra samayo vutto, upayogena so idhā’’ti.
But the ancients explain -- "at that time", or, "by that time", or, "at one time", this is only a difference in expression, everywhere the meaning is locative. Therefore, even when "at one time" is said, the meaning should be understood as "at one time."
Nhưng các vị thời xưa giải thích – "tasmiṃ samaye" (trong thời đó), hoặc "tena samayenā" (vào thời đó), hoặc "ekaṃ samayaṃ" (một thời), đây chỉ là sự khác biệt về cách nói, ở mọi nơi, ý nghĩa là sở thuộc. Cho nên dù nói "ekaṃ samayaṃ" (một thời), ý nghĩa cần phải hiểu là "ekasmiṃ samaye" (trong một thời).
Porāṇā pana vaṇṇayanti – ‘‘tasmiṃ samaye’’ti vā, ‘‘tena samayenā’’ti vā, ‘‘ekaṃ samaya’’nti vā, abhilāpamattabhedo esa, sabbattha bhummamevatthoti. Tasmā ‘‘ekaṃ samaya’’nti vuttepi ‘‘ekasmiṃ samaye’’ti attho veditabbo.
Because He is venerable. For in the world, they say that the Fortunate One is venerable. And He is venerable to all beings due to His being distinguished by all virtues; therefore, He should be known as the Fortunate One. The ancients also said:
*Bhagavā* (Bậc Thế Tôn) là đáng tôn kính. Vì ở đời, người ta gọi bậc đáng tôn kính là *Bhagavā*. Và Ngài là bậc tôn kính của tất cả chúng sanh, vì Ngài đặc biệt hơn hết bởi đầy đủ mọi đức hạnh, do vậy cần phải hiểu Ngài là *Bhagavā*. Các bậc cổ đức cũng đã nói:
Bhagavāti garu. Garuñhi loke bhagavāti vadanti. Ayañca sabbaguṇavisiṭṭhatāya sabbasattānaṃ garu, tasmā bhagavāti veditabbo. Porāṇehipi vuttaṃ –
"The word 'Fortunate One' is the highest; the word 'Fortunate One' is the supreme;
"Lời *Bhagavā* là tối thượng, lời *Bhagavā* là cao tột;
‘‘Bhagavāti vacanaṃ seṭṭhaṃ, bhagavāti vacanamuttamaṃ;
He is venerable and worthy of reverence; therefore, He is called the Fortunate One."
Ngài đáng cung kính, đầy đủ sự tôn trọng, do vậy được gọi là *Bhagavā*."
Garu gāravayutto so, bhagavā tena vuccatī’’ti.
And also:
Lại nữa:
Api ca –
"He is fortunate, possesses merit, is endowed with advantages, and is separated from attachments;
"Ngài là bậc có phúc, bậc phá trừ ác pháp, bậc tương ưng, bậc phân chia các pháp;
‘‘Bhāgyavā bhaggavā yutto, bhagehi ca vibhattavā;
He is devoted, has abandoned wandering, in existences, and therefore is the Fortunate One."
Bậc đã thực hành, bậc đoạn tận tham ái, trong các hữu, do vậy là *Bhagavā*."
Bhattavā vantagamano, bhavesu bhagavā tato’’ti.
The detailed meaning of this verse's words should be understood. It has already been stated in the Visuddhimagga in the section on Recollection of the Buddha.
Cần phải hiểu ý nghĩa rộng của danh xưng này theo bài kệ ấy. Và điều đó đã được nói trong phần niệm ân đức Phật ở Thanh Tịnh Đạo.
Imissā gāthāya vasenassa padassa vitthāraattho veditabbo. So ca visuddhimagge buddhānussatiniddese vuttoyeva.
Thus, by saying, "Thus have I heard," he displays the Dhamma as it was heard, making the Fortunate One's Dhamma-body manifest. Thereby, he comforts people who are distressed by not seeing the Teacher, thinking, "This is not the teaching of a Teacher who has passed away; this is your Teacher."
Ở đây, với câu "Như vầy tôi nghe," Ngài trình bày Pháp như đã được nghe, và hiển lộ Pháp thân của Đức Thế Tôn. Nhờ đó, Ngài làm cho những người đang ưu sầu vì không được thấy bậc Đạo Sư an tâm rằng: "Đây không phải là lời dạy của một vị Đạo Sư đã quá vãng, mà đây là bậc Đạo Sư của các ngươi."
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ dassento bhagavato dhammakāyaṃ paccakkhaṃ karoti. Tena ‘‘nayidaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
By saying, "At one time the Fortunate One," he indicates the non-existence of the Fortunate One at that time, establishing the passing away of the Form-body. Thereby, he instills a sense of urgency in those intoxicated by the vanity of life, thinking, "The Teacher of such a noble Dhamma, the bearer of the Ten Powers, whose body was like a thunderbolt, even that Fortunate One has passed away, in whom else should one place hope in life?" and he generates zeal for the True Dhamma.
Với câu "Một thời, Thế Tôn," Ngài chỉ rõ sự vắng mặt của Đức Thế Tôn vào thời điểm đó, và xác định sự viên tịch của sắc thân. Nhờ đó, Ngài làm cho những người còn say đắm trong sự sống tỉnh ngộ rằng: "Ngay cả bậc Đạo Sư của Chánh Pháp thù diệu như vậy, bậc có đầy đủ thập lực, có thân thể vững chắc như kim cương, cũng đã nhập Niết Bàn, thì còn ai có thể hy vọng vào sự sống?" Và Ngài làm phát sinh sự tinh tấn của người ấy đối với Chánh Pháp.
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti. Tena ‘‘evaṃvidhassa nāma ariyadhammassa desako dasabaladharo vajirasaṅghāta samānakāyo sopi bhagavā parinibbuto, kena aññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
By saying "Thus," he indicates the accomplishment of the teaching. By "have I heard," the accomplishment of the disciple. By "At one time," the accomplishment of the time. By "the Fortunate One," the accomplishment of the Teacher.
Và khi nói "Như vầy", Ngài chỉ rõ sự đầy đủ của bài thuyết pháp. "Tôi nghe" là chỉ sự đầy đủ của hàng đệ tử. "Một thời" là chỉ sự đầy đủ của thời gian. "Thế Tôn" là chỉ sự đầy đủ của bậc thuyết pháp.
Evanti ca bhaṇanto desanāsampattiṃ niddisati. Me sutanti sāvakasampattiṃ. Ekaṃ samayanti kālasampattiṃ. Bhagavāti desakasampattiṃ.
"Between Rājagaha and Nāḷandā" - The word 'between' is seen in the senses of cause, moment, mind, middle, interval, and so on. Here, in the sense of 'interval', the word 'between' occurs, thus: "Who could know that interval, except for the Tathāgata?" and "People gather and discuss, what is the difference between me and you?" the word 'between' means 'cause'. In, "Venerable sir, a certain woman saw me washing dishes in the interval of lightning," it means 'moment'. In, "For whom there are no angers in the interval," it means 'mind'. In "Established decay in the interval," it means 'middle'. In "And, monks, this Taponadi flows in the interval between the two great hells", it means 'interval'. Here it applies in the sense of 'interval'. Therefore, the meaning here should be understood as 'in the interval between Rājagaha and Nāḷandā'. Because it is connected with the word 'between', the accusative case is used. In such places, grammarians use only one word 'between', as in "He goes between the village and the river", which should also be connected with the second word; if it is not connected, it does not attain the accusative case. But here it is said to be connected.
*Antarā ca rājagahaṃ antarā ca nāḷandanti* (giữa Rājagaha và Nāḷandā): Chữ *antarā* được thấy trong các nghĩa như nguyên nhân, sát-na, trung tâm, khoảng trống, v.v... Trong các câu như "Ai có thể biết được khoảng cách (nguyên nhân) đó, ngoại trừ Như Lai?" và "Dân chúng bàn luận với nhau, khoảng cách (nguyên nhân) giữa ta và họ là gì?", thì chữ *antarā* có nghĩa là nguyên nhân. Trong các câu như "Bạch Thế Tôn, con đã thấy một người phụ nữ đang rửa chén bát ở khoảng trống (sát-na) giữa hai tia chớp", thì có nghĩa là sát-na. Trong các câu như "Từ bên trong (tâm) người ấy, không có những sân hận", thì có nghĩa là tâm. Trong các câu như "Đạt đến sự chấm dứt ở khoảng giữa (trung tâm)", thì có nghĩa là trung tâm. Trong các câu như "Và này các Tỳ kheo, hồ Tapodā này đi vào khoảng trống (khe hở) giữa hai đại địa ngục", thì có nghĩa là khoảng trống. Ở đây, chữ ấy được dùng với nghĩa khoảng trống, vì vậy, ở đây cần phải hiểu nghĩa là khoảng trống giữa Rājagaha và Nāḷandā. Vì được kết hợp với chữ *antarā*, nên đã chia cách thành sở dụng cách. Và ở những trường hợp như vậy, các nhà chú giải văn tự thường chỉ sử dụng một chữ *antarā*, như trong câu "Đi giữa (antarā) làng và sông", chữ ấy cũng cần phải được kết hợp với từ thứ hai, nếu không kết hợp thì không đạt được sở dụng cách. Nhưng ở đây, đã nói rõ là kết hợp.
Antarā ca rājagahaṃ antarā ca nāḷandanti antarā-saddo kāraṇakhaṇacittavemajjhavivarādīsu dissati. ‘‘Tadantaraṃ ko jāneyya aññatra tathāgatā’’ti (a. ni. 6.44) ca, ‘‘janā saṅgamma mantenti mañca tañca kimantara’’nti (saṃ. ni. 1.228) ca ādīsu hi kāraṇe antarā-saddo. ‘‘Addasa maṃ, bhante, aññatarā itthī vijjantarikāya bhājanaṃ dhovantī’’tiādīsu (ma. ni. 2.149) khaṇe. ‘‘Yassantarato na santi kopā’’tiādīsu (udā. 20) citte. ‘‘Antarā vosānamāpādī’’tiādīsu (cūḷava. 350) vemajjhe. ‘‘Api cāyaṃ, bhikkhave, tapodā dvinnaṃ mahānirayānaṃ antarikāya āgacchatī’’tiādīsu (pārā. 231) vivare. Svāyamidha vivare vattati, tasmā rājagahassa ca nāḷandāya ca vivareti evametthattho veditabbo. Antarā-saddena pana yuttattā upayogavacanaṃ kataṃ. Īdisesu ca ṭhānesu akkharacintakā ‘‘antarā gāmañca nadiñca yātī’’ti evaṃ ekameva antarāsaddaṃ payujjanti, so dutiyapadenapi yojetabbo hoti, ayojiyamāne upayogavacanaṃ na pāpuṇāti. Idha pana yojetvāyeva vuttoti.
He was journeying along the highway – He was journeying along the road known as the highway, meaning 'the long road'. Because in the division of the time of journeying along the highway, from the statement, "I will eat, thinking I will go half a yojana," etc., even half a yojana is a highway. But from Rājagaha to Nāḷandā is only one yojana.
*Addhānamaggappaṭipannohotīti* (đang đi trên con đường trường): là đang đi trên con đường được gọi là đường trường, nghĩa là "con đường dài". Vì khi phân chia thời gian đi đường trường, có câu nói "sẽ ăn khi đi nửa do tuần" (nửa do-tuần = khoảng 5-7 km), thì nửa do tuần cũng là đường trường. Từ Rājagaha đến Nāḷandā chỉ có một do tuần (khoảng 11-15 km).
Addhānamaggappaṭipannohotīti addhānasaṅkhātaṃ maggaṃ paṭipanno hoti, ‘‘dīghamagga’’nti attho. Addhānagamanasamayassa hi vibhaṅge ‘‘aḍḍhayojanaṃ gacchissāmīti bhuñjitabba’’ntiādivacanato (pāci. 218) aḍḍhayojanampi addhānamaggo hoti. Rājagahato pana nāḷandā yojanameva.
Together with a great Saṅgha of monks - 'Great' means great in virtue, and also great in number. For that Saṅgha of monks was great in virtues, being endowed with the virtues of contentment, and so on. It was also great in number, being five hundred in number. The Saṅgha of monks is the 'Saṅgha of monks', with that Saṅgha of monks. It means the assembly of recluses characterized by the aggregation of common views and virtue. 'Together with' means 'as one'.
*Mahatā bhikkhusaṅghena saddhinti* (cùng với đại chúng Tỳ kheo): 'đại chúng' là lớn về mặt phẩm chất, cũng lớn về mặt số lượng. Đại chúng Tỳ kheo ấy lớn về mặt phẩm chất, vì đầy đủ các phẩm chất như thiểu dục tri túc, v.v... Về số lượng cũng lớn, vì có đến năm trăm vị. Chúng Tỳ kheo là 'bhikkhusaṅgha', cùng với chúng Tỳ kheo ấy. Nghĩa là cùng với nhóm người tu hành, được gọi là tập hợp của những điểm tương đồng về kiến thức và giới hạnh. *Saddhinti* (cùng với) là cùng nhau.
Mahatā bhikkhusaṅghena saddhinti ‘mahatā’ti guṇamahattenapi mahatā, saṅkhyāmahattenapi mahatā. So hi bhikkhusaṅgho guṇehipi mahā ahosi, appicchatādiguṇasamannāgatattā. Saṅkhyāyapi mahā, pañcasatasaṅkhyattā. Bhikkhūnaṃ saṅgho ‘bhikkhusaṅgho’, tena bhikkhusaṅghena. Diṭṭhisīlasāmaññasaṅghātasaṅkhātena samaṇagaṇenāti attho. Saddhinti ekato.
With five hundred monks – 'Around five' means that five is their limit. 'Limit' means 'measure'. Therefore, just as when it is said, "He is moderate in eating," the meaning is, "He knows moderation in eating, he knows the measure," so too here, the meaning should be seen as – "Of those hundreds of monks, five is the limit, five is the measure." Hundreds of monks are 'hundreds of monks'; with those five hundred monks.
*Pañcamattehi bhikkhusatehīti* (với khoảng năm trăm vị Tỳ kheo): những vị này có năm (vị) làm số lượng, nên gọi là khoảng năm (vị). *Mattā* (khoảng) được gọi là số lượng, vì vậy, như khi nói "biết lượng vừa đủ trong ăn uống", nghĩa là "biết lượng vừa đủ trong ăn uống, biết số lượng", thì ở đây cũng vậy – cần phải hiểu nghĩa là "trong số hàng trăm vị Tỳ kheo ấy, năm (vị) làm số lượng, khoảng năm (trăm vị)". Hàng trăm vị Tỳ kheo là *bhikkhusatāni*, với khoảng năm trăm vị Tỳ kheo ấy.
Pañcamattehi bhikkhusatehīti pañcamattā etesanti pañcamattāni. Mattāti pamāṇaṃ vuccati, tasmā yathā ‘‘bhojane mattaññū’’ti vutte ‘‘bhojane mattaṃ jānāti, pamāṇaṃ jānātī’’ti attho hoti, evamidhāpi – ‘‘tesaṃ bhikkhusatānaṃ pañcamattā pañcapamāṇa’’nti evamattho daṭṭhabbo. Bhikkhūnaṃ satāni bhikkhusatāni, tehi pañcamattehi bhikkhusatehi.
Suppiya the wanderer, as well – 'Suppiya' is his name. The particle 'also' serves to aggregate individuals in the context of being fellow travelers on the road. The particle 'indeed' is connective of clauses, and is used due to euphonic combination. 'Wanderer' means a follower of Sañjaya, one of the six wanderers. What is said is this – "When the Fortunate One set out on that highway, at that time Suppiya the wanderer also set out." The word 'was' here has the sense of past time.
*Suppiyopikho paribbājako* (và du sĩ Suppiya): *Suppiya* là tên của vị ấy. Chữ *Pi* có nghĩa tóm gọn các cá nhân có cùng tính chất đang đi trên đường. Chữ *Kho* là từ nối câu, được nói theo cách liền mạch các phụ âm. *Paribbājako* (du sĩ) là đệ tử của Sañjaya, một trong sáu du sĩ ngoại đạo. Điều này được nói là – "Khi Đức Thế Tôn đang đi trên con đường trường ấy, thì du sĩ Suppiya cũng đang đi." Chữ *hoti* ở đây có nghĩa thì quá khứ.
Suppiyopikho paribbājakoti suppiyoti tassa nāmaṃ. Pi-kāro maggappaṭipannasabhāgatāya puggalasampiṇḍanattho. Kho-kāro padasandhikaro, byañjanasiliṭṭhatāvasena vutto. Paribbājakoti sañjayassa antevāsī channaparibbājako. Idaṃ vuttaṃ hoti – ‘‘yadā bhagavā taṃ addhānamaggaṃ paṭipanno, tadā suppiyopi paribbājako paṭipanno ahosī’’ti. Atītakālattho hettha hoti-saddo.
Together with his disciple, the youth Brahmadatta – Here, 'he dwells near' means 'disciple'. It means 'one who attends closely', 'one who is near', 'a pupil'. 'Brahmadatta' is his name. 'Youth' can mean a being, a thief, or a young person.
*Saddhiṃ antevāsinā brahmadattena māṇavenāti* (cùng với đệ tử tên Brahmadatta) – ở đây, người ở gần gọi là *antevāsī*. Nghĩa là người hầu cận, người ở gần, đệ tử. *Brahmadatta* là tên của vị ấy. *Māṇava* (chàng trai trẻ) có khi được gọi là người, có khi là kẻ trộm, có khi là thanh niên.
Saddhiṃ antevāsinā brahmadattena māṇavenāti – ettha ante vasatīti antevāsī. Samīpacāro santikāvacaro sissoti attho. Brahmadattoti tassa nāmaṃ. Māṇavoti sattopi coropi taruṇopi vuccati.
"Urged on by divine messengers, those beings who are negligent;
"Được các thiên sứ nhắc nhở, những người (māṇavā) nào buông lung;
‘‘Coditā devadūtehi, ye pamajjanti māṇavā;
They grieve for a long time, men who are reborn in lower realms."
Những người ấy sầu muộn lâu dài, là những người đi đến cõi thấp kém."
Te dīgharattaṃ socanti, hīnakāyūpagā narā’’ti. (ma. ni. 3.271) –
In the above, 'youth' means 'being'. In "They associate with youths, both skilled and unskilled," 'youth' means 'thief'. In "Ambaṭṭha the youth, Aṅgaka the youth," 'youth' means 'young person'. Here also, this is the meaning. What is said here is this – together with a young disciple named Brahmadatta.
Trong các câu trên, người được gọi là *māṇava*. "Họ đến cùng với cả những *māṇava* (kẻ trộm) đã làm và chưa làm việc ác", thì kẻ trộm được gọi là *māṇava*. "Chàng trai trẻ (māṇavo) Ambaṭṭha, chàng trai trẻ (māṇavo) Aṅgaka", thì thanh niên được gọi là ‘māṇavo’. Ở đây cũng có nghĩa này. Điều này được nói là – cùng với người đệ tử thanh niên tên Brahmadatta.
Ādīsu hi satto māṇavoti vutto. ‘‘Māṇavehipi samāgacchanti katakammehipi akatakammehipī’’tiādīsu (ma. ni. 2.149) coro. ‘‘Ambaṭṭho māṇavo, aṅgako māṇavo’’tiādīsu (dī. ni. 1.316) taruṇo ‘māṇavo’ti vutto. Idhāpi ayamevattho. Idañhi vuttaṃ hoti – brahmadattena nāma taruṇantevāsinā saddhinti.
There – In that highway, or among those two people. 'Indeed' is merely a particle. In various ways – The word 'way' applies to turn, teaching, and reason. In "Whose turn is it today, Ānanda, to instruct the nuns?" 'way' applies to 'turn'. In "Hold it as the Honeyball Discourse," it applies to 'teaching'. In "In this way too, O king, let it be so," it applies to 'reason'. Here also it applies to 'reason', therefore the meaning here is – "with various reasons," meaning "with many reasons".
*Tatrāti* (ở đó): trên con đường trường ấy, hoặc trong hai người ấy. *Sudanti* (quả thật) chỉ là một tiểu từ. *Anekapariyāyenāti* (bằng nhiều phương diện): Chữ *pariyāya* (phương diện) được dùng trong các nghĩa như thời gian, bài thuyết pháp, nguyên nhân. Trong các câu như "Này Ānanda, hôm nay đến phiên (pariyāyo) của ai giáo giới các Tỳ kheo ni?", thì chữ *pariyāya* có nghĩa là thời gian. Trong các câu như "Hãy ghi nhớ nó là bài thuyết pháp về viên mật (Madhupiṇḍikapariyāyotveva)", thì có nghĩa là bài thuyết pháp. Trong các câu như "Và này vua, theo phương diện (pariyāyena) này, hãy là như vậy", thì có nghĩa là nguyên nhân. Ở đây, nó cũng có nghĩa là nguyên nhân, vì vậy nghĩa ở đây là – "bằng nhiều loại nguyên nhân", nghĩa là "bằng nhiều nguyên nhân".
Tatrāti tasmiṃ addhānamagge, tesu vā dvīsu janesu. Sudanti nipātamattaṃ. Anekapariyāyenāti pariyāya-saddo tāva vāradesanākāraṇesu vattati. ‘‘Kassa nu kho, ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ntiādīsu (ma. ni. 3.398) hi vāre pariyāyasaddo vattati. ‘‘Madhupiṇḍikapariyāyotveva naṃ dhārehī’’tiādīsu (ma. ni. 1.205) desanāyaṃ. ‘‘Imināpi kho, te rājañña, pariyāyena evaṃ hotū’’tiādīsu (dī. ni. 2.411) kāraṇe. Svāyamidhāpi kāraṇe vattati, tasmā ayamettha attho – ‘‘anekavidhena kāraṇenā’’ti, ‘‘bahūhi kāraṇehī’’ti vuttaṃ hoti.
He speaks dispraise of the Buddha - Even of the Buddha, the Fortunate One, who is devoid of dispraise and endowed with immeasurable praise, "That respectful duty to be done towards those who are advanced in birth in the world, the act of salutation, etc., is called 'the essence of harmony', that is not present in the recluse Gotama, therefore the recluse Gotama is devoid of essence, is without enjoyment, is a denier of action, is an annihilationist, is contemptible, is a disciplinarian, is an ascetic, is not prolific. The recluse Gotama does not possess any superhuman state, a worthy distinction of knowledge and vision. The recluse Gotama teaches a Dhamma that is reached by reasoning, investigated by deliberation, and of his own devising. The recluse Gotama is not all-knowing, not a knower of the world, not unsurpassed, not the highest person." Thus, speaking this and that non-reason as a reason, he speaks dispraise, fault, and blame in various ways.
*Buddhassa avaṇṇaṃ bhāsatīti* (nói lời hủy báng Đức Phật): nói lời hủy báng, chê bai, chỉ trích Đức Phật, bậc Thế Tôn, dù Ngài không có gì đáng chê trách, mà đầy đủ vô lượng đức tánh – "Việc chào hỏi, v.v..., là những việc nên làm đối với những người lớn tuổi, được gọi là 'hương vị của sự hòa hợp', thì Sa môn Gotama không có, vì vậy Sa môn Gotama là người không có hương vị, không có của cải, chủ trương không có hành động, chủ trương đoạn diệt, đáng ghê tởm, người hướng dẫn sai lầm, người khổ hạnh, không có thai tạng. Sa môn Gotama không có pháp siêu nhân, không có tri kiến thù thắng xứng đáng bậc Thánh. Sa môn Gotama thuyết pháp do suy luận, do suy xét, do tự mình nghĩ ra. Sa môn Gotama không phải là bậc Toàn Giác, không phải là bậc Liễu Tri Thế Gian, không phải là bậc Vô Thượng, không phải là bậc Tối Thượng." Như vậy, nói điều này điều kia không phải là nguyên nhân mà cho là nguyên nhân, và nói những lời hủy báng, chê bai, chỉ trích như vậy.
Buddhassa avaṇṇaṃ bhāsatīti avaṇṇavirahitassa aparimāṇavaṇṇasamannāgatassāpi buddhassa bhagavato – ‘‘yaṃ loke jātivuḍḍhesu kattabbaṃ abhivādanādisāmīcikammaṃ ‘sāmaggiraso’ti vuccati, taṃ samaṇassa gotamassa natthi tasmā arasarūpo samaṇo gotamo, nibbhogo, akiriyavādo, ucchedavādo, jegucchī, venayiko, tapassī, apagabbho. Natthi samaṇassa gotamassa uttarimanussadhammo alamariyañāṇadassanaviseso. Takkapariyāhataṃ samaṇo gotamo dhammaṃ deseti, vīmaṃsānucaritaṃ, sayaṃpaṭibhānaṃ. Samaṇo gotamo na sabbaññū, na lokavidū, na anuttaro, na aggapuggalo’’ti. Evaṃ taṃ taṃ akāraṇameva kāraṇanti vatvā tathā tathā avaṇṇaṃ dosaṃ nindaṃ bhāsati.
And just as of the Buddha, so too of the Dhamma, speaking this and that non-reason as a reason, he speaks dispraise in various ways, saying – "The Dhamma of the recluse Gotama is badly proclaimed, badly penetrated, not leading to liberation, not conducive to peace."
Và như đối với Đức Phật, đối với Giáo Pháp cũng vậy, nói điều này điều kia không phải là nguyên nhân mà cho là nguyên nhân – "Giáo Pháp của Sa môn Gotama khéo nói, khéo chứng ngộ, không có tính chất hướng thượng, không đưa đến an tịnh," và nói những lời hủy báng như vậy.
Yathā ca buddhassa, evaṃ dhammassāpi taṃ taṃ akāraṇameva kāraṇato vatvā – ‘‘samaṇassa gotamassa dhammo durakkhāto, duppaṭivedito, aniyyāniko, anupasamasaṃvattaniko’’ti tathā tathā avaṇṇaṃ bhāsati.
And just as of the Dhamma, so too of the Saṅgha, speaking whatever non-reason as a reason, he speaks dispraise in various ways, saying – "The Saṅgha of disciples of the recluse Gotama is wrongly practicing, crookedly practicing, practicing in a hostile way, in a way that is not conducive, in a way that is conducive to unrighteousness."
Và như đối với Giáo Pháp, đối với Tăng Chúng cũng vậy, nói bất cứ điều gì không phải là nguyên nhân mà cho là nguyên nhân – "Chúng đệ tử của Sa môn Gotama thực hành sai lầm, thực hành quanh co, thực hành nghịch lại, thực hành không tương ưng, thực hành tương ưng với phi pháp," và nói những lời hủy báng như vậy.
Yathā ca dhammassa, evaṃ saṅghassāpi yaṃ vā taṃ vā akāraṇameva kāraṇato vatvā – ‘‘micchāpaṭipanno samaṇassa gotamassa sāvakasaṅgho, kuṭilapaṭipanno, paccanīkapaṭipadaṃ ananulomapaṭipadaṃ adhammānulomapaṭipadaṃ paṭipanno’’ti tathā tathā avaṇṇaṃ bhāsati.
But his disciple – "Our teacher is touching what should not be touched, is treading on what should not be trodden upon, he is like one swallowing fire, like one touching the blade of a sword with his hand, like one wishing to crush Mount Sineru with his fist, like one playing with a saw-toothed row of teeth, like one seizing a wild elephant in musth with his hand, and speaking dispraise of the Triple Gem, which deserves praise, he will incur misfortune and disaster. But when a teacher treads on excrement, or fire, or thorns, or a black snake, or mounts a stake, or eats deadly poison, or pours out corrosive liquid, or falls into a chasm of hell, it is not for the disciple to imitate all that. Beings are owners of their kamma, and go to a destination according to their kamma. Neither does a father go by the kamma of his son, nor a son by the kamma of his father, nor a mother by the kamma of her son, nor a son by the kamma of his mother, nor a brother by the kamma of his sister, nor a sister by the kamma of her brother, nor a teacher by the kamma of his disciple, nor a disciple by the kamma of his teacher. And my teacher is speaking dispraise of the Three Jewels, but the upbraiding of the Noble Ones is very blameworthy. Thus, wisely reflecting, crushing the teacher's views, pointing out only the right reasons as reasons, he began to speak the praise of the Three Jewels in various ways, as that well-born son of a noble family is of a wise nature." Therefore, it is said – "But Suppiya the wanderer's disciple, the youth Brahmadatta, speaks praise of the Buddha in various ways, speaks praise of the Dhamma, speaks praise of the Saṅgha."
*Antevāsī panassa* (nhưng người đệ tử của vị ấy): "Vị thầy của chúng ta đang xúc phạm điều không nên xúc phạm, đang giẫm lên điều không nên giẫm lên, vị ấy như đang nuốt lửa, như đang dùng tay chạm vào lưỡi kiếm, như muốn dùng nắm đấm đập vỡ núi Tu Di, như đang đùa với hàng răng cưa, như đang dùng tay bắt con voi dữ đang say vì chảy mủ, và đang nói lời hủy báng Tam Bảo đáng được ca ngợi. Nhưng khi vị thầy giẫm lên phân, hoặc lửa, hoặc gai, hoặc rắn độc, hoặc leo lên giàn hỏa thiêu, hoặc ăn thuốc độc halāhala, hoặc rưới nước sôi lên người, hoặc rơi xuống vực thẳm địa ngục, thì người đệ tử không nên làm theo tất cả những điều đó. Vì chúng sanh là chủ nhân của nghiệp, đi theo con đường tương ưng với nghiệp của mình. Không phải cha đi theo nghiệp của con, không phải con đi theo nghiệp của cha, không phải mẹ đi theo nghiệp của con, không phải con đi theo nghiệp của mẹ, không phải anh đi theo nghiệp của em, không phải em đi theo nghiệp của anh, không phải thầy đi theo nghiệp của trò, không phải trò đi theo nghiệp của thầy. Và vị thầy của ta đang nói lời hủy báng Tam Bảo, nhưng sự chỉ trích bậc Thánh là một trọng tội." Như vậy, sau khi khéo léo thoát ra, người ấy bác bỏ lời nói của vị thầy, chỉ ra những nguyên nhân đúng đắn, và bắt đầu nói lời ca ngợi Tam Bảo bằng nhiều phương diện, như một người con của gia đình có trí tuệ." Vì vậy, đã nói – "Nhưng Brahmadatta, người đệ tử của du sĩ Suppiya, nói lời ca ngợi Đức Phật bằng nhiều phương diện, nói lời ca ngợi Giáo Pháp, nói lời ca ngợi Tăng Chúng."
Antevāsī panassa – ‘‘amhākaṃ ācariyo aparāmasitabbaṃ parāmasati, anakkamitabbaṃ akkamati, svāyaṃ aggiṃ gilanto viya, hatthena asidhāraṃ parāmasanto viya, muṭṭhinā sineruṃ padāletukāmo viya, kakacadantapantiyaṃ kīḷamāno viya, pabhinnamadaṃ caṇḍahatthiṃ hatthena gaṇhanto viya ca vaṇṇārahasseva ratanattayassa avaṇṇaṃ bhāsamāno anayabyasanaṃ pāpuṇissati. Ācariye kho pana gūthaṃ vā aggiṃ vā kaṇṭakaṃ vā kaṇhasappaṃ vā akkamante, sūlaṃ vā abhirūhante, halāhalaṃ vā visaṃ khādante, khārodakaṃ vā pakkhalante, narakapapātaṃ vā papatante, na antevāsinā taṃ sabbamanukātabbaṃ hoti. Kammassakā hi sattā attano kammānurūpameva gatiṃ gacchanti. Neva pitā puttassa kammena gacchati, na putto pitu kammena, na mātā puttassa, na putto mātuyā, na bhātā bhaginiyā, na bhaginī bhātu, na ācariyo antevāsino, na antevāsī ācariyassa kammena gacchati. Mayhañca ācariyo tiṇṇaṃ ratanānaṃ avaṇṇaṃ bhāsati, mahāsāvajjo kho panāriyūpavādoti. Evaṃ yoniso ummujjitvā ācariyavādaṃ maddamāno sammākāraṇameva kāraṇato apadisanto anekapariyāyena tiṇṇaṃ ratanānaṃ vaṇṇaṃ bhāsitumāraddho, yathā taṃ paṇḍitajātiko kulaputto’’. Tena vuttaṃ – ‘‘suppiyassa pana paribbājakassa antevāsī brahmadatto māṇavo anekapariyāyena buddhassa vaṇṇaṃ bhāsati, dhammassa vaṇṇaṃ bhāsati, saṅghassa vaṇṇaṃ bhāsatī’’ti.
There, the word "vaṇṇa" is seen in [the meanings of] shape, type, physical appearance, basis, measure, quality, praise, and so on. Of these, in such [usages] as, "having created a great serpent-king's form," shape is meant. In such [usages] as, "Brahmins are the best class, any other class is inferior," type [is meant]. In such [usages] as, "endowed with supreme beauty of complexion," physical appearance [is meant].
Ở đây, chữ "vaṇṇa" (sắc, phẩm chất) được thấy trong các nghĩa như hình dáng, chủng tộc, sắc xứ, nguyên nhân, mức độ, đức hạnh, và sự khen ngợi. Trong đó, câu "tạo ra hình dáng của một con rắn chúa to lớn" nói đến hình dáng. Câu "Chỉ có Bà-la-môn là chủng tộc cao quý, còn các chủng tộc khác là thấp hèn" nói đến chủng tộc. Câu "具足 tối thượng sắc viên mãn" (具足 = cụ túc, đầy đủ; tối thượng sắc viên mãn: vẻ đẹp hoàn hảo tột bậc) nói đến sắc xứ.
Tattha vaṇṇanti vaṇṇa-saddo saṇṭhāna-jāti-rūpāyatana-kāraṇa-pamāṇa-guṇa-pasaṃsādīsu dissati . Tattha ‘‘mahantaṃ sapparājavaṇṇaṃ abhinimminitvā’’tiādīsu (saṃ. ni. 1.142) saṇṭhānaṃ vuccati. ‘‘Brāhmaṇova seṭṭho vaṇṇo, hīno añño vaṇṇo’’tiādīsu (ma. ni. 2.402) jāti. ‘‘Paramāya vaṇṇapokkharatāya samannāgato’’tiādīsu (dī. ni. 1.303) rūpāyatanaṃ.
"I do not take, I do not break, I only smell the lotus,
"Con không ăn trộm, không làm hại, chỉ ngửi đóa hoa sen;
‘‘Na harāmi na bhañjāmi, ārā siṅghāmi vārijaṃ;
Then by what basis, am I called a thief of scent?"
Vậy do nhân duyên gì, được gọi là kẻ trộm hương?" –
Atha kena nu vaṇṇena, gandhatthenoti vuccatī’’ti. (saṃ. ni. 1.234) –
In such [usages] as the above, basis [is meant]. In such [usages] as, "The bowl has three measures," measure [is meant]. In such [usages] as, "When, householder, were these qualities of the recluse Gotama praised by you?," quality [is meant]. In such [usages] as, "He speaks the praise of one worthy of praise," praise [is meant]. Here, both quality and praise [are meant]. Indeed, this [Suppiya] referring to each actual basis, spoke praise associated with the qualities of the Triple Gem in many ways. Therein - "Thus indeed, is that Blessed One, accomplished, fully enlightened" and so on, by this method, "Monks, those who have faith in the Buddha, have faith in the best" and so on, "One person, monks, arising in the world, arises... incomparable, peerless," and so on; by these methods, the Buddha's praise should be understood. "Well-proclaimed by the Blessed One is the Dhamma" and "uprooting of attachment, ending the cycle," and, "Monks, those who have faith in the Noble Eightfold Path, have faith in the best," and so on; by these methods, the Dhamma's praise should be understood. "Of good conduct is the Blessed One's Saṅgha of disciples" and, "Monks, those who have faith in the Saṅgha, have faith in the best," and so on; by these methods, the Saṅgha's praise should be understood. However, a capable Dhamma speaker, having immersed himself in the five collections, the ninefold dispensation of the Teacher, the eighty-four thousand sections of Dhamma, should expound the praise of the Buddha and the others. At this point, one expounding the qualities of the Buddha and the others cannot be said to be a Dhamma speaker who hastens on insatiably. In such circumstances, the strength of the Dhamma speaker should be recognized. But the youth Brahmadatta speaks the praise of the Triple Gem with his own strength, only according to hearsay.
Trong những câu trên, nói đến nguyên nhân. Câu "Có ba mức độ của bát" nói đến mức độ. Câu "Này gia chủ, khi nào thì những phẩm chất này của Sa-môn Cù-đàm mới được kết tập?" nói đến đức hạnh. Câu "Khen ngợi người đáng được khen ngợi" nói đến sự khen ngợi. Ở đây, cả đức hạnh và sự khen ngợi đều được bao hàm. Người này (Suppiya) đã nói lên sự khen ngợi, bao gồm những đức hạnh của Tam Bảo bằng nhiều cách, chỉ ra những nguyên nhân chân thật khác nhau. Ở đây – "Thế Tôn ấy là bậc A-la-hán, Chánh Đẳng Giác" theo cách này, "Này các Tỳ-kheo, những ai tịnh tín nơi Đức Phật, họ tịnh tín nơi tối thượng" và "Một người, này các Tỳ-kheo, khi xuất hiện ở đời…v.v… không ai sánh bằng, không ai ngang bằng", phẩm chất của Đức Phật cần phải được hiểu theo những cách này. "Pháp được Thế Tôn khéo thuyết giảng" và "Sự nhổ tận gốc ái, sự đoạn diệt luân hồi", và "Này các Tỳ-kheo, những ai tịnh tín nơi Bát Thánh Đạo, họ tịnh tín nơi tối thượng", phẩm chất của Pháp cần phải được hiểu theo những cách như vậy. "Chúng Tăng đệ tử của Thế Tôn khéo thực hành" và "Này các Tỳ-kheo, những ai tịnh tín nơi Tăng, họ tịnh tín nơi tối thượng", phẩm chất của Tăng cần phải được hiểu theo những cách như vậy. Tuy nhiên, một pháp sư có khả năng cần phải thâm nhập vào năm bộ Nikāya, chín phần giáo lý của bậc Đạo Sư, tám vạn bốn ngàn pháp uẩn, để làm sáng tỏ phẩm chất của Đức Phật và các bậc khác. Ở đây, không thể nói rằng vị pháp sư ấy là kẻ đắm nhiễm không biết đủ khi làm sáng tỏ những đức hạnh của Đức Phật và các bậc khác. Ở những nơi như vậy, sức mạnh của pháp sư cần phải được nhận biết. Tuy nhiên, thanh niên Brahmadatta nói lên phẩm chất của Tam Bảo bằng sức mạnh của chính mình, chỉ liên quan đến những điều được nghe.
Ādīsu kāraṇaṃ. ‘‘Tayo pattassa vaṇṇā’’tiādīsu (pārā. 602) pamāṇaṃ. ‘‘Kadā saññūḷhā pana, te gahapati, ime samaṇassa gotamassa vaṇṇā’’tiādīsu (ma. ni. 2.77) guṇo. ‘‘Vaṇṇārahassa vaṇṇaṃ bhāsatī’’tiādīsu (a. ni. 2.135) pasaṃsā. Idha guṇopi pasaṃsāpi. Ayaṃ kira taṃ taṃ bhūtameva kāraṇaṃ apadisanto anekapariyāyena ratanattayassa guṇūpasañhitaṃ pasaṃsaṃ abhāsi. Tattha – ‘‘itipi so bhagavā arahaṃ sammāsambuddho’’tiādinā (pārā. 1) nayena, ‘‘ye bhikkhave, buddhe pasannā agge te pasannā’’tiādinā ‘‘ekapuggalo, bhikkhave, loke uppajjamāno uppajjati…pe… asamo asamasamo’’tiādinā (a. ni. 1.174) ca nayena buddhassa vaṇṇo veditabbo. ‘‘Svākkhāto bhagavatā dhammo’’ti (dī. ni. 2.159) ca ‘‘ālayasamugghāto vaṭṭupacchedo’’ti (iti. 90, a. ni. 4.34) ca, ‘‘ye bhikkhave, ariye aṭṭhaṅgike magge pasannā, agge te pasannā’’ti ca evamādīhi nayehi dhammassa vaṇṇo veditabbo. ‘‘Suppaṭipanno bhagavato sāvakasaṅgho’’ti (dī. ni. 2.159) ca, ‘‘ye, bhikkhave, saṅghe pasannā, agge te pasannā’’ti (a. ni. 4.34) ca evamādīhi pana nayehi saṅghassa vaṇṇo veditabbo. Pahontena pana dhammakathikena pañcanikāye navaṅgaṃ satthusāsanaṃ caturāsītidhammakkhandhasahassāni ogāhitvā buddhādīnaṃ vaṇṇo pakāsetabbo. Imasmiñhi ṭhāne buddhādīnaṃ guṇe pakāsento atitthena pakkhando dhammakathikoti na sakkā vattuṃ. Īdisesu hi ṭhānesu dhammakathikassa thāmo veditabbo. Brahmadatto pana māṇavo anussavādimattasambandhitena attano thāmena ratanattayassa vaṇṇaṃ bhāsati.
"Thus, these two, teacher and pupil" means thus, these two, teacher and pupil. "Uttering speech directly opposed to each other" means that without omitting even a little, they spoke various contradictory speeches directly, they repeatedly engaged in opposing debates. When the teacher spoke dispraise of the Triple Gem, the pupil spoke praise. Again, the other spoke dispraise, the other praise. Thus, the teacher, like one striking a loosened nail on a post, repeatedly spoke dispraise of the Triple Gem. But the pupil, like one blocking that nail with a golden, silver, or jeweled pin, repeatedly spoke praise of the Triple Gem. Therefore, it is said – "Uttering speech directly opposed to each other".
"Itiha te ubho ācariyantevāsī"ti (Như vậy, cả hai thầy trò ấy) có nghĩa là hai thầy trò như vậy. "Aññamaññassā"ti (lẫn nhau) có nghĩa là người này đối với người kia. "Ujuvipaccanīkavādā"ti (luôn tranh luận trái ngược nhau) có nghĩa là tranh luận trái ngược nhau một cách trực tiếp, không lẩn tránh dù chỉ một chút, luôn tranh luận trái ngược nhau nhiều lần. Khi thầy nói lên những điều không tốt về Tam Bảo, người học trò nói lên những điều tốt, rồi người kia nói lên những điều không tốt, người kia nói lên những điều tốt, cứ như vậy, người thầy giống như gõ cái đinh cong trên tấm gỗ lim, liên tục nói lên những điều không tốt về Tam Bảo. Còn người học trò giống như dùng cái đinh bằng vàng, bạc, hoặc ngọc để đóng lại cái đinh cong ấy, liên tục nói lên những điều tốt đẹp về Tam Bảo. Vì vậy, nói rằng – "luôn tranh luận trái ngược nhau".
Itiha te ubho ācariyantevāsīti evaṃ te dve ācariyantevāsikā. Aññamaññassāti añño aññassa. Ujuvipaccanīkavādāti īsakampi apariharitvā ujumeva vividhapaccanīkavādā, anekavāraṃ viruddhavādā eva hutvāti attho. Ācariyena hi ratanattayassa avaṇṇe bhāsite antevāsī vaṇṇaṃ bhāsati, puna itaro avaṇṇaṃ, itaro vaṇṇanti evaṃ ācariyo sāraphalake visarukkhaāṇiṃ ākoṭayamāno viya punappunaṃ ratanattayassa avaṇṇaṃ bhāsati. Antevāsī pana suvaṇṇarajatamaṇimayāya āṇiyā taṃ āṇiṃ paṭibāhayamāno viya punappunaṃ ratanattayassa vaṇṇaṃ bhāsati. Tena vuttaṃ – ‘‘ujuvipaccanīkavādā’’ti.
"They followed closely behind the Blessed One and the Saṅgha of monks" means they followed behind the Blessed One and the Saṅgha of monks, without abandoning the sight [of them], they followed them, accompanying them, keeping their movements in view, keeping their heads lifted in observation, they were followers.
"Theo sát Đức Thế Tôn và chúng Tỳ-kheo từ phía sau" có nghĩa là đi theo Đức Thế Tôn và chúng Tỳ-kheo từ phía sau, không rời mắt khỏi hình ảnh phía sau, đi theo với dáng đi, có nghĩa là đi theo sau, chiêm ngưỡng từ đầu.
Bhagavantaṃ piṭṭhito piṭṭhito anubandhā honti bhikkhusaṅghañcāti bhagavantañca bhikkhusaṅghañca pacchato pacchato dassanaṃ avijahantā iriyāpathānubandhanena anubandhā honti, sīsānulokino hutvā anugatā hontīti attho.
Why, then, did the Blessed One undertake that journey? And why did Suppiya follow? And why did he speak dispraise of the Triple Gem? The Blessed One, at that time, having stayed in one of the eighteen great monasteries around Rājagaha, having attended to his bodily needs early in the morning, surrounded by the Saṅgha of monks, went for alms in Rājagaha at the time for alms-round. On that day, having secured an easy alms-round for the Saṅgha of monks, after the meal, having returned from the alms-round, he had the Saṅgha of monks take their bowls and robes, and – "I will go to Nāḷanda" – having departed from Rājagaha, he undertook that journey. Suppiya also, at that time, staying in a certain wanderers' park around Rājagaha, surrounded by wanderers, went for alms in Rājagaha. He also, on that day, having secured an easy alms-round for the company of wanderers, having had his morning meal, had the wanderers take the wanderers' requisites, and – I will go to Nāḷanda – not knowing that the Blessed One had undertaken that path, he followed. If he had known, he would not have followed. While going, not knowing, lifting his neck and looking, he saw the Blessed One, shining with the glory of Buddhahood, like a walking golden mountain peak covered with a red blanket.
Nhưng vì sao Đức Thế Tôn đi trên con đường đó? Và vì sao Suppiya đi theo sau? Và vì sao người ấy nói những điều không tốt về Tam Bảo? Đức Thế Tôn, vào thời điểm đó, sau khi an cư ở một trong mười tám tu viện lớn xung quanh Rājagaha (Vương Xá thành), vào buổi sáng sớm, sau khi chăm sóc thân thể, cùng với chúng Tỳ-kheo đi vào Rājagaha để khất thực vào giờ đi khất thực. Ngày hôm đó, sau khi làm cho chúng Tỳ-kheo có được đồ ăn khất thực dễ dàng, sau buổi ăn, khi đã thọ trai xong, Ngài bảo chúng Tỳ-kheo mang theo y bát – "Ta sẽ đi đến Nāḷanda", rời khỏi Rājagaha và đi trên con đường đó. Suppiya, vào thời điểm đó, sau khi an cư tại một tu viện của ngoại đạo xung quanh Rājagaha, cùng với các ngoại đạo đi vào Rājagaha để khất thực. Ngày hôm đó, sau khi làm cho các ngoại đạo có được đồ ăn khất thực dễ dàng, sau khi ăn sáng xong, bảo các ngoại đạo mang theo đồ dùng của ngoại đạo – cũng với ý định đi đến Nāḷanda, không biết rằng Đức Thế Tôn đã đi trên con đường đó, nên đã đi theo sau. Nhưng nếu biết, người ấy đã không đi theo. Vì không biết, người ấy đi, ngẩng cổ lên nhìn, thấy Đức Thế Tôn đang tỏa sáng với vẻ uy nghiêm của Đức Phật, giống như đỉnh núi vàng đang di chuyển được khoác lên tấm vải đỏ.
Kasmā pana bhagavā taṃ addhānaṃ paṭipanno? Kasmā ca suppiyo anubandho? Kasmā ca so ratanattayassa avaṇṇaṃ bhāsatīti? Bhagavā tāva tasmiṃ kāle rājagahaparivattakesu aṭṭhārasasu mahāvihāresu aññatarasmiṃ vasitvā pātova sarīrappaṭijagganaṃ katvā bhikkhācāravelāyaṃ bhikkhusaṅghaparivuto rājagahe piṇḍāya carati. So taṃ divasaṃ bhikkhusaṅghassa sulabhapiṇḍapātaṃ katvā pacchābhattaṃ piṇḍapātapaṭikkanto bhikkhusaṅghaṃ pattacīvaraṃ gāhāpetvā – ‘‘nāḷandaṃ gamissāmī’’ti, rājagahato nikkhamitvā taṃ addhānaṃ paṭipanno. Suppiyopi kho tasmiṃ kāle rājagahaparivattake aññatarasmiṃ paribbājakārāme vasitvā paribbājakaparivuto rājagahe bhikkhāya carati. Sopi taṃ divasaṃ paribbājakaparisāya sulabhabhikkhaṃ katvā bhuttapātarāso paribbājake paribbājakaparikkhāraṃ gāhāpetvā – nāḷandaṃ gamissāmicceva bhagavato taṃ maggaṃ paṭipannabhāvaṃ ajānantova anubandho. Sace pana jāneyya nānubandheyya. So ajānitvāva gacchanto gīvaṃ ukkhipitvā olokayamāno bhagavantaṃ addasa buddhasiriyā sobhamānaṃ rattakambalaparikkhittamiva jaṅgamakanakagirisikharaṃ.
At that time, emanating from the body of the Ten-Powered One, six-colored rays went forth and back, across an area eighty cubits in all directions, like a garland of jewels, a string of jewels, scattered with jewel powder, like an unfurled tapestry of precious stones and gold, like molten red gold, like the combined falling of hundreds of meteors, like a mass of continuously scattered coral flowers, like Chinese chalk dust scattered by the force of the wind, like the spreading diffusion of the luster of rainbows, lightning, and groups of stars, filling the space between the trees.
Vào thời điểm đó, từ thân thể của Đấng Thập Lực, sáu loại tia sáng phóng ra, chạy qua chạy lại trong khu vực rộng tám mươi khuỷu tay xung quanh, giống như được rải bằng chuỗi ngọc, vòng ngọc, bột ngọc, giống như tấm thảm vàng và lụa quý được trải ra, giống như được tưới bằng nước vàng đỏ, giống như đầy dẫy hàng trăm tia lửa, giống như hoa kaṇikāra (hoa hoàng hậu, hoa muồng hoàng yến) được rải liên tục, giống như bột mì Trung Quốc bị gió mạnh thổi tung, và giống như ánh sáng cầu vồng, tia chớp, và các vì sao chiếu sáng rực rỡ khắp khu rừng.
Tasmiṃ kira samaye dasabalassa sarīrato nikkhamitvā chabbaṇṇarasmiyo samantā asītihatthappamāṇe padese ādhāvanti vidhāvanti ratanāveḷaratanadāmaratanacuṇṇavippakiṇṇaṃ viya, pasāritaratanacittakañcanapaṭamiva, rattasuvaṇṇarasanisiñcamānamiva, ukkāsatanipātasamākulamiva, nirantaravippakiṇṇakaṇikārapupphamiva vāyuvegakkhittacīnapiṭṭhacuṇṇamiva, indadhanuvijjulatātārāgaṇappabhāvisaravipphuritaviccharitamiva ca taṃ vanantaraṃ hoti.
And the Blessed One's body, adorned with the eighty minor marks, was like a blossoming lotus and water lily, a grove with all its trees in full bloom, a coral tree, a sky adorned with stars and rays of light, surpassing the splendor of the firmament, and his halo of a fathom's length, along with the thirty-two excellent marks, like a thirty-two moon garland, a thirty-two sun garland, set out in order, outshone the splendor of thirty-two wheel-turning monarchs, thirty-two Sakka, kings of the gods, and thirty-two great Brahmas. And the monks standing around the Blessed One, all were content with little, satisfied, secluded, unattached, instructors, reprovers of evil, speakers, able to bear speech, perfected in virtuous behavior, perfected in concentration, wisdom, freedom and the knowledge and vision of freedom. Among them, the Blessed One was like a golden pillar encircled by a wall of red blankets, like a golden boat in the middle of a cluster of red lotuses, like a mass of fire surrounded by a coral railing, like the full moon surrounded by a host of stars, he delighted the eyes even of animals and birds, let alone gods and humans. And on that day, mostly the eighty great elders, having put on one shoulder their dust-heap robes, the color of clouds, taking their staffs, like perfumed elephants made of gold, without faults, having abandoned faults, with their defilements destroyed, with their tangles untangled, with their bonds cut, surrounded the Blessed One. He, himself free from lust, surrounded by those free from lust, himself free from hatred, surrounded by those free from hatred, himself free from delusion, surrounded by those free from delusion, himself free from craving, surrounded by those free from craving, himself without defilements, surrounded by those without defilements, himself enlightened, surrounded by those who were enlightened; like a stamen surrounded by petals, like a pericarp surrounded by stamens, like Chaddanta the elephant king, surrounded by eighty thousand elephants, like Dhataraṭṭha the goose king, surrounded by ninety thousand geese, like a wheel-turning king surrounded by his retinue, like Sakka, king of the gods, surrounded by a host of gods, like Hārita the great Brahma, surrounded by a host of Brahmas, with the incomparable, unthinkable, Buddha-glory that arose from the power of merit accumulated over immeasurable time, like the moon in the sky, he journeyed along that path.
Và thân thể của Đức Thế Tôn, được trang điểm bằng tám mươi vẻ đẹp phụ, giống như hoa sen và hoa súng nở rộ, giống như cây pāricchattaka (cây vông đồng) nở đầy hoa, giống như bầu trời đầy sao và ánh sáng, dường như vượt qua vẻ đẹp của bầu trời, và hào quang rộng một sải tay của Ngài, tỏa sáng với ba mươi hai tướng tốt, giống như vượt qua vẻ đẹp của ba mươi hai vòng hoa mặt trăng, ba mươi hai vòng hoa mặt trời, ba mươi hai vị Chuyển Luân Thánh Vương, ba mươi hai vị trời Đế Thích, ba mươi hai vị Đại Phạm Thiên được sắp xếp theo thứ tự. Và các vị Tỳ-kheo đứng xung quanh Đức Thế Tôn, tất cả đều là những vị ít ham muốn, biết đủ, sống viễn ly, không giao du, là những người chỉ lỗi, chê trách điều ác, là những người nói năng hợp lý, là những người kham nhẫn lời nói, đầy đủ giới hạnh, đầy đủ định, tuệ, giải thoát, và giải thoát tri kiến. Ở giữa họ, Đức Thế Tôn giống như một cây cột vàng được bao quanh bởi hàng rào vải đỏ, giống như một chiếc thuyền vàng giữa một đám sen đỏ, giống như một ngọn lửa được bao quanh bởi một hàng rào san hô, giống như mặt trăng tròn được bao quanh bởi các vì sao, làm vui lòng ngay cả đôi mắt của các loài thú và chim, huống chi là chư thiên và loài người. Và vào ngày hôm đó, phần lớn tám mươi vị Đại Trưởng lão đắp y phấn tảo màu mây, đắp một bên vai, cầm gậy, giống như những con voi hương tượng được ủ bằng vàng, đã diệt trừ các lỗi lầm, đã nôn ra các lỗi lầm, đã phá vỡ các phiền não, đã cắt đứt các búi tóc, đã chặt đứt các ràng buộc, vây quanh Đức Thế Tôn. Ngài, tự mình đã lìa tham, cùng với những người đã lìa tham; tự mình đã lìa sân, cùng với những người đã lìa sân; tự mình đã lìa si, cùng với những người đã lìa si; tự mình đã lìa ái, cùng với những người đã lìa ái; tự mình đã không còn phiền não, cùng với những người không còn phiền não; tự mình đã giác ngộ, cùng với những người đã giác ngộ theo; giống như nhụy hoa được bao quanh bởi cánh hoa, giống như đài hoa được bao quanh bởi nhụy hoa, giống như vua voi Chaddanta (voi sáu ngà) được bao quanh bởi tám ngàn con voi, giống như vua ngỗng Dhataraṭṭha (ngỗng Trì Quốc) được bao quanh bởi chín vạn con ngỗng, giống như vua Chuyển Luân Thánh Vương được bao quanh bởi quân đội, giống như vua trời Đế Thích được bao quanh bởi chư thiên, giống như Đại Phạm Thiên Hārita được bao quanh bởi chư Phạm Thiên, đã đi trên con đường đó, giống như mặt trăng trên bầu trời, với oai nghi của Đức Phật không thể nghĩ bàn, không thể so sánh, được sinh ra từ sức mạnh của công đức đã tích lũy trong vô lượng kiếp.
Asīti anubyañjanānurañjitañca pana bhagavato sarīraṃ vikasitakamaluppalamiva, saraṃ sabbapāliphullamiva pāricchattakaṃ, tārāmarīcivikasitamiva, gaganatalaṃ siriyā avahasantamiva, byāmappabhāparikkhepavilāsinī cassa dvattiṃsavaralakkhaṇamālā ganthetvā ṭhapitadvattiṃsacandamālāya dvattiṃsasūriyamālāya paṭipāṭiyā ṭhapitadvattiṃsacakkavattidvattiṃsasakkadevarājadvattiṃsamahābrahmānaṃ siriṃ siriyā abhibhavantimiva. Tañca pana bhagavantaṃ parivāretvā ṭhitā bhikkhū sabbeva appicchā santuṭṭhā pavivittā asaṃsaṭṭhā codakā pāpagarahino vattāro vacanakkhamā sīlasampannā samādhipaññāvimuttivimuttiññāṇadassanasampannā. Tesaṃ majjhe bhagavā rattakambalapākāraparikkhitto viya kañcanathambho, rattapadumasaṇḍamajjhagatā viya suvaṇṇanāvā, pavāḷavedikāparikkhitto viya aggikkhandho, tārāgaṇaparivārito viya puṇṇacando migapakkhīnampi cakkhūni pīṇayati, pageva devamanussānaṃ. Tasmiñca pana divase yebhuyyena asītimahātherā meghavaṇṇaṃ paṃsukūlaṃ ekaṃsaṃ karitvā kattaradaṇḍaṃ ādāya suvammavammitā viya gandhahatthino vigatadosā vantadosā bhinnakilesā vijaṭitajaṭā chinnabandhanā bhagavantaṃ parivārayiṃsu. So sayaṃ vītarāgo vītarāgehi, sayaṃ vītadoso vītadosehi, sayaṃ vītamoho vītamohehi, sayaṃ vītataṇho vītataṇhehi, sayaṃ nikkileso nikkilesehi, sayaṃ buddho anubuddhehi parivārito; pattaparivāritaṃ viya kesaraṃ, kesaraparivāritā viya kaṇṇikā, aṭṭhanāgasahassaparivārito viya chaddanto nāgarājā, navutihaṃsasahassaparivārito viya dhataraṭṭho haṃsarājā, senaṅgaparivārito viya cakkavattirājā, devagaṇaparivārito viya sakko devarājā, brahmagaṇaparivārito viya hārito mahābrahmā, aparimitakālasañcitapuññabalanibbattāya acinteyyāya anopamāya buddhalīlāya cando viya gaganatalaṃ taṃ maggaṃ paṭipanno hoti.
Then, the wanderer, seeing the Blessed One thus going with incomparable Buddha-glory, and the monks, with downcast eyes, with controlled senses, with peaceful minds, just paying homage to the Blessed One, like the full moon situated in the upper sky, he surveyed his own assembly. They were loaded with various burdens of requisites, carrying water pots hanging from carrying poles, and had untidy and disheveled bundles of requisites on their backs, carrying staffs and peacock feathers. "The hands of so-and-so are beautiful, the feet of so-and-so" – thus uttering pointless words, verbose, with scattered speech, they were unsightly and uninspiring. Seeing them, remorse arose in him.
Và khi thấy Đức Thế Tôn đang đi với oai nghi không thể so sánh của Đức Phật, và thấy các Tỳ-kheo mắt nhìn xuống, các căn được an tịnh, tâm ý được an tịnh, giống như mặt trăng tròn trên bầu trời, chỉ đảnh lễ Đức Thế Tôn, vị ngoại đạo liền nhìn lại chúng của mình. Chúng ấy chất đầy gánh nặng với nhiều đồ dùng như giỏ, gậy, túi vải đựng bát bằng đất, bình nước, v.v... được treo trên đòn gánh. Ồn ào với những lời nói vô nghĩa như "Tay của người này đẹp, chân của người kia đẹp", nói năng lung tung, không đáng nhìn, không đáng kính. Thấy vậy, người ấy (Suppiya) sinh lòng hối hận.
Athevaṃ bhagavantaṃ anopamāya buddhalīlāya gacchantaṃ bhikkhū ca okkhittacakkhū santindriye santamānase uparinabhe ṭhitaṃ puṇṇacandaṃ viya bhagavantaṃyeva namassamāne disvāva paribbājako attano parisaṃ avalokesi. Sā hoti kājadaṇḍake olambetvā gahitoluggaviluggapiṭṭhakatidaṇḍamorapiñchamattikāpattapasibbakakuṇḍikādianekaparikkhārabhārabharitā . ‘‘Asukassa hatthā sobhaṇā, asukassa pādā’’ti evamādiniratthakavacanā mukharā vikiṇṇavācā adassanīyā apāsādikā. Tassa taṃ disvā vippaṭisāro udapādi.
Now, the praise of the Blessed One should be spoken by him. But because this one is always finding fault with the Blessed One due to the loss of gains, honor and followers. For the non-Buddhists, gains and honor arise only as long as a Buddha does not arise in the world; but from the arising of a Buddha onwards, their gains and honor diminish. They become lusterless, like fireflies at the rising of the sun. And when Upatissa and Kolita went forth under Sañjaya, the wanderers had a great following, but when those two left, their company also broke up. Thus, for these two reasons, this wanderer, because he is always finding fault with the Blessed One, should be understood to be speaking dispraise of the Triple Gem while spewing forth that venom of fault-finding.
Giờ đây, những phẩm hạnh của Đức Thế Tôn nên được nói đến. Bởi lẽ, tên ngoại đạo này luôn ganh tị với Đức Thế Tôn, cả về sự tổn thất lợi lộc, cúng dường và sự suy giảm đồ chúng. Quả thật, đối với các ngoại đạo, khi Đức Phật chưa xuất hiện ở đời, thì lợi lộc và cúng dường vẫn phát sinh; nhưng từ khi Đức Phật xuất hiện, lợi lộc và cúng dường của họ bị suy giảm, trở nên tàn lụi như đom đóm khi mặt trời mọc. Và khi Upatissa (Xá-lợi-phất) và Kolita (Mục-kiền-liên) xuất gia với Sañjaya, các du sĩ ngoại đạo đã có một hội chúng lớn, nhưng khi hai vị ấy ra đi, hội chúng của họ cũng tan rã. Vì hai lý do này, du sĩ ngoại đạo này luôn ganh tị với Đức Thế Tôn, nên khi tuôn ra những lời ganh tị, chỉ trích ấy, cần hiểu rằng ông ta đang nói những lời bất kính đối với Tam Bảo.
Idāni tena bhagavato vaṇṇo vattabbo bhaveyya. Yasmā panesa lābhasakkārahāniyā ceva pakkhahāniyā ca niccampi bhagavantaṃ usūyati. Aññatitthiyānañhi yāva buddho loke nuppajjati, tāvadeva lābhasakkārā nibbattanti, buddhuppādato pana paṭṭhāya parihīnalābhasakkārā honti , sūriyuggamane khajjopanakā viya nissirīkataṃ āpajjanti. Upatissakolitānañca sañjayassa santike pabbajitakāleyeva paribbājakā mahāparisā ahesuṃ, tesu pana pakkantesu sāpi tesaṃ parisā bhinnā. Iti imehi dvīhi kāraṇehi ayaṃ paribbājako yasmā niccampi bhagavantaṃ usūyati, tasmā taṃ usūyavisuggāraṃ uggiranto ratanattayassa avaṇṇameva bhāsatīti veditabbo.
2. Then the Blessed One, while traveling with that Buddha-gait, gradually arrived at the gate of Ambalaṭṭhikā and looking at the sun, he went for a one-night stay in the king's pleasure-house in Ambalaṭṭhikā, thinking, "It is now too late to go; the sun has almost set".
2. Rồi Đức Thế Tôn, cùng với chúng Tỳ-kheo, đã trú đêm tại Rājāgāraka (nhà nghỉ của vua) ở Ambalaṭṭhikā. Đức Thế Tôn, đi theo phong thái của một vị Phật, tuần tự đến cổng Ambalaṭṭhikā, nhìn mặt trời và nói: "Bây giờ đã quá giờ để đi, mặt trời đã gần lặn," nên Ngài đã trú đêm tại Rājāgāraka ở Ambalaṭṭhikā.
2.Atha kho bhagavā ambalaṭṭhikāyaṃ rājāgārake ekarattivāsaṃ upagacchi saddhiṃ bhikkhusaṅghenāti bhagavā tāya buddhalīlāya gacchamāno anupubbena ambalaṭṭhikādvāraṃ pāpuṇitvā sūriyaṃ oloketvā – ‘‘akālo dāni gantuṃ, atthasamīpaṃ gato sūriyo’’ti ambalaṭṭhikāyaṃ rājāgārake ekarattivāsaṃ upagacchi.
There, Ambalaṭṭhikā is the king's pleasure garden. It is said that there is a young mango tree near its gate, which is called "Ambalaṭṭhikā". Because it is not far from that, the pleasure garden too has come to be known as Ambalaṭṭhikā. It is endowed with shade and water, enclosed by a wall, with well-arranged gates, well-guarded like a casket. There, they built a house for the king's amusement, decorated with imaginative and varied paintings. That is called the "king's pleasure-house".
Ở đó, Ambalaṭṭhikā là ngự uyển của vua. Nghe nói rằng, gần cổng của nó có một cây xoài non, được gọi là "Ambalaṭṭhikā." Vì ở gần đó, ngự uyển cũng được gọi là Ambalaṭṭhikā. Nó đầy đủ bóng mát và nước, được bao quanh bởi tường thành, có cổng được thiết kế đẹp, được bảo vệ cẩn mật như một chiếc hộp quý. Ở đó, người ta đã xây một ngôi nhà lộng lẫy với những bức tranh đầy nghệ thuật để vua giải trí. Nó được gọi là "Rājāgāraka."
Tattha ambalaṭṭhikāti rañño uyyānaṃ. Tassa kira dvārasamīpe taruṇaambarukkho atthi, taṃ ‘‘ambalaṭṭhikā’’ti vadanti. Tassa avidūre bhavattā uyyānampi ambalaṭṭhikā tveva saṅkhyaṃ gataṃ. Taṃ chāyūdakasampannaṃ pākāraparikkhittaṃ suyojitadvāraṃ mañjusā viya suguttaṃ. Tattha rañño kīḷanatthaṃ paṭibhānacittavicittaṃ agāraṃ akaṃsu. Taṃ ‘‘rājāgāraka’’nti vuccati.
And Suppiya, Suppiya, too, at that place, looked at the sun, and thinking, "Now it is too late to go; there are many young and old wanderers, and this road is frequented by many companies, even by thieves, fierce yakkhas, and wild beasts. But this ascetic Gotama has entered the pleasure garden, and where the ascetic Gotama dwells, the deities keep guard. Well, then, I too will spend one night here and depart tomorrow," he entered that same pleasure garden. Then the Saṅgha of bhikkhus, having shown their respects to the Blessed One, took note of their own dwelling places. The wanderer too, having set down his wanderer's requisites on one side of the pleasure garden, went to stay with his own company. But in the Pāḷi itself it is said: "with his own disciple, the young man Brahmadatta".
Suppiya cũng vậy, Suppiya cũng nhìn mặt trời ở nơi đó và nói: "Bây giờ đã quá giờ để đi, có rất nhiều du sĩ ngoại đạo trẻ và già, và con đường này có rất đông người, cũng có những kẻ trộm cướp, dạ xoa hung ác, và thú dữ. Sa-môn Gotama này đã vào ngự uyển, và ở nơi Sa-môn Gotama ở, chư thiên sẽ bảo vệ, vậy ta cũng sẽ trú đêm ở đây và sẽ đi vào ngày mai." Rồi ông ta đi vào chính ngự uyển đó. Sau đó, chúng Tỳ-kheo đã thực hiện các phận sự đối với Đức Thế Tôn và tìm chỗ ở cho riêng mình. Du sĩ ngoại đạo cũng hạ đồ đạc của mình xuống ở một góc của ngự uyển, và trú đêm cùng với hội chúng của mình. Nhưng trong Pāḷi (Kinh tạng), đã được nói là: "cùng với đệ tử của mình là thanh niên Brahmadatta."
Suppiyopi khoti suppiyopi tasmiṃ ṭhāne sūriyaṃ oloketvā – ‘‘akālo dāni gantuṃ, bahū khuddakamahallakā paribbājakā, bahuparissayo ca ayaṃ maggo corehipi vāḷayakkhehipi vāḷamigehipi. Ayaṃ kho pana samaṇo gotamo uyyānaṃ paviṭṭho, samaṇassa ca gotamassa vasanaṭṭhāne devatā ārakkhaṃ gaṇhanti, handāhampi idha ekarattivāsaṃ upagantvā sveva gamissāmī’’ti tadevuyyānaṃ pāvisi. Tato bhikkhusaṅgho bhagavato vattaṃ dassetvā attano attano vasanaṭṭhānaṃ sallakkhesi. Paribbājakopi uyyānassa ekapasse paribbājakaparikkhāre otāretvā vāsaṃ upagacchi saddhiṃ attano parisāya. Pāḷiyamārūḷhavaseneva pana – ‘‘saddhiṃ attano antevāsinā brahmadattena māṇavenā’’ti vuttaṃ.
Having gone to stay thus, that wanderer, during the night, observed the Ten-Powered One. And at that time, the lamps were burning like stars scattered all around, and the Blessed One was seated in the middle, and the Saṅgha of bhikkhus surrounded the Blessed One. There, not even one bhikkhu made any movement of the hands, or any movement of the feet, or the sound of coughing, or the sound of sneezing. For that assembly, both because of their own well-trained nature and out of reverence for the Teacher, remained as still as the flame of a lamp in a windless place. The wanderer, seeing that magnificent sight, observed his own company. There, some were waving their hands, some their feet, some were babbling, some with slobbering tongues, dripping with spittle, gnashing their teeth, making cawing sounds, and sleeping with snoring breaths. Though he should have spoken of the qualities and praise of the Triple Gem, he began to speak of dispraise again out of envy. But Brahmadatta, in the manner already stated, spoke praise. Therefore, it is said: "There also, indeed, the wanderer Suppiya" all should be stated. There, "There also" means in that, that is, in the pleasure garden of Ambalaṭṭhikā.
Du sĩ ngoại đạo này, sau khi trú đêm như vậy, đã quan sát Đức Thế Tôn vào ban đêm. Vào thời điểm đó, những ngọn đèn sáng rực như những vì sao rải rác khắp nơi, Đức Thế Tôn ngồi ở giữa, và chúng Tỳ-kheo vây quanh Đức Thế Tôn. Trong đó, không một Tỳ-kheo nào có cử chỉ tay chân bồn chồn, hay tiếng ho, tiếng hắt hơi. Hội chúng đó, nhờ sự huấn luyện kỹ càng của bản thân và lòng tôn kính đối với bậc Đạo Sư, đã ngồi yên lặng như ngọn đèn không bị gió thổi, vì hai lý do đó. Du sĩ ngoại đạo nhìn thấy cảnh tượng trang nghiêm đó, liền quan sát hội chúng của mình. Trong đó, có người vung tay, có người vung chân, có người nói nhảm, có người lè lưỡi chảy nước dãi, nhai răng, phì phò thở, nằm ngáy. Dù đáng lẽ phải nói về ân đức của Tam Bảo, nhưng vì ganh tị, ông ta lại bắt đầu nói lời bất kính. Nhưng Brahmadatta, như đã nói, đã ca ngợi. Do đó, đã nói: "Ở đó, du sĩ ngoại đạo Suppiya," tất cả đều nên được nói. Ở đó, "ở đó" nghĩa là ở ngự uyển Ambalaṭṭhikā đó.
Evaṃ vāsaṃ upagato pana so paribbājako rattibhāge dasabalaṃ olokesi. Tasmiñca samaye samantā vippakiṇṇatārakā viya padīpā jalanti, majjhe bhagavā nisinno hoti, bhikkhusaṅgho ca bhagavantaṃ parivāretvā. Tattha ekabhikkhussapi hatthakukkuccaṃ vā pādakukkuccaṃ vā ukkāsitasaddo vā khipitasaddo vā natthi. Sā hi parisā attano ca sikkhitasikkhatāya satthari ca gāravenāti dvīhi kāraṇehi nivāte padīpasikhā viya niccalā sannisinnāva ahosi. Paribbājako taṃ vibhūtiṃ disvā attano parisaṃ olokesi. Tattha keci hatthaṃ khipanti, keci pādaṃ, keci vippalapanti, keci nillālitajivhā paggharitakheḷā, dante khādantā kākacchamānā gharugharupassāsino sayanti. So ratanattayassa guṇavaṇṇe vattabbepi issāvasena puna avaṇṇameva ārabhi. Brahmadatto pana vuttanayeneva vaṇṇaṃ. Tena vuttaṃ – ‘‘tatrāpi sudaṃ suppiyo paribbājako’’ti sabbaṃ vattabbaṃ. Tattha tatrāpīti tasmimpi, ambalaṭṭhikāyaṃ uyyāneti attho.
3. Of many means of many. There, according to the Vinaya context, three people are called "many". Beyond that is the Saṅgha. But according to the Sutta context, three are only three, and from then on they are many. Here, "many" should be understood according to the Sutta context. In the circular pavilion, sometimes a hall with a peaked roof made with two crossbeams covered with a goose-foot pattern is also called a "circular pavilion"; sometimes an assembly hall made with one crossbeam and encircling a row of pillars is also called a "circular pavilion". But here, a sitting hall should be understood as a "circular pavilion". Of those seated together means by way of sitting. Of those assembled together means by way of gathering. This topic of conversation means discussion, the topic of conversation, is the meaning. Arose means arose. And which one is that? It is amazing, friends, thus and so on. There, like a blind man's ascent of a mountain, it does not always happen, thus it is amazing. This is the etymology of the word. But this is the explanation in the commentary: that which is fit for striking a finger-snap, is amazing. That is, it is suitable for snapping one's fingers. That which has never been before, has become, is wonderful. Both of these are expressions of astonishment. As far as this, it indicates the immeasurability due to its being thoroughly well-penetrated by him.
3. Nhiều người, nghĩa là số đông. Ở đó, theo Luật tạng, ba người được gọi là "nhiều người." Hơn thế nữa là Tăng chúng. Nhưng theo Kinh tạng, ba người và từ đó trở đi là nhiều người. Ở đây, nên hiểu "nhiều người" theo nghĩa của Kinh tạng. Maṇḍalamāḷe (Pháp đường tròn), ở một nơi, một pháp đường được xây bằng cách lấy hai cây cột chính, mái che hình con ngỗng, cũng được gọi là "Maṇḍalamāḷa," ở một nơi, một pháp đường phục vụ được xây bằng cách lấy một cây cột chính và đặt các hàng cột xung quanh, cũng được gọi là "Maṇḍalamāḷa." Nhưng ở đây, nên hiểu "Maṇḍalamāḷa" là pháp đường để ngồi. Sannisinnānaṃ, nghĩa là theo cách ngồi. Sannipatitānaṃ, nghĩa là theo cách tập hợp. Saṅkhiyādhamma (Pháp thoại), saṅkhiyā là lời nói, nghĩa là pháp thoại. Udapādi, nghĩa là đã khởi lên. Cái nào vậy? Thật kỳ diệu, này các Hiền giả, vân vân. Ở đó, như người mù leo núi, không xảy ra thường xuyên, nên là kỳ diệu. Đây là cách hiểu theo ngữ nguyên. Nhưng đây là cách hiểu theo Chú giải: Acchariyayoga (Xứng đáng tán thán) nghĩa là Acchariya (Kỳ diệu). Nghĩa là xứng đáng để tán thán. Abhūtapubbaṃ bhūtaṃ (Điều chưa từng có nay đã có), nghĩa là Abbhuta (Tuyệt diệu). Cả hai đều là từ đồng nghĩa của Vimhaya (Sự kinh ngạc). Yāvañcidaṃ (Cho đến mức độ này), cho thấy tính vô lượng do được biết rõ ràng.
3.Sambahulānanti bahukānaṃ. Tattha vinayapariyāyena tayo janā ‘‘sambahulā’’ti vuccanti. Tato paraṃ saṅgho. Suttantapariyāyena pana tayo tayova tato paṭṭhāya sambahulā. Idha suttantapariyāyena ‘‘sambahulā’’ti veditabbā. Maṇḍalamāḷeti katthaci dve kaṇṇikā gahetvā haṃsavaṭṭakacchannena katā kūṭāgārasālāpi ‘‘maṇḍalamāḷo’’ti vuccati, katthaci ekaṃ kaṇṇikaṃ gahetvā thambhapantiṃ parikkhipitvā katā upaṭṭhānasālāpi ‘‘maṇḍalamāḷo’’ti vuccati. Idha pana nisīdanasālā ‘‘maṇḍalamāḷo’’ti veditabbo. Sannisinnānanti nisajjanavasena. Sannipatitānanti samodhānavasena. Ayaṃ saṅkhiyadhammoti saṅkhiyā vuccati kathā , kathādhammoti attho. Udapādīti uppanno. Katamo pana soti? Acchariyaṃ āvusoti evamādi. Tattha andhassa pabbatārohaṇaṃ viya niccaṃ na hotīti acchariyaṃ. Ayaṃ tāva saddanayo. Ayaṃ pana aṭṭhakathānayo – accharāyogganti acchariyaṃ. Accharaṃ paharituṃ yuttanti attho. Abhūtapubbaṃ bhūtanti abbhutaṃ. Ubhayaṃ petaṃ vimhayassevādhivacanaṃ. Yāvañcidanti yāva ca idaṃ tena suppaṭividitatāya appameyyattaṃ dasseti.
By that Blessed One, knowing…etc… thoroughly well-penetrated, this is the summarized meaning here. He, that Blessed One, having fulfilled the thirty perfections, having shattered all defilements, fully enlightened to the unsurpassed perfect enlightenment, by that Blessed One, knowing the dispositions and underlying tendencies of those various beings, seeing all knowable things like a myrobalan fruit placed on the palm of his hand.
Với Đức Thế Tôn kia, Người biết... được biết rất rõ ràng, đây là ý nghĩa tóm tắt. Đức Thế Tôn kia, người đã viên mãn ba mươi Ba-la-mật, đoạn trừ tất cả phiền não, chứng đắc Vô thượng Chánh đẳng giác, Đức Thế Tôn kia, Người biết rõ khuynh hướng và tùy miên của các chúng sinh, Người thấy rõ tất cả các pháp cần biết như trái amla (me rừng) đặt trên lòng bàn tay.
Tena bhagavatā jānatā…pe… suppaṭividitāti etthāyaṃ saṅkhepattho. Yo so bhagavā samatiṃsa pāramiyo pūretvā sabbakilese bhañjitvā anuttaraṃ sammāsambodhiṃ abhisambuddho, tena bhagavatā tesaṃ tesaṃ sattānaṃ āsayānusayaṃ jānatā, hatthatale ṭhapitaṃ āmalakaṃ viya sabbañeyyadhammaṃ passatā.
And also, knowing by means of recollection of past lives and so forth, seeing with the divine eye. Knowing by means of the three knowledges or the six supernormal knowledges, seeing with the unobstructed universal eye everywhere. Knowing with the wisdom capable of knowing all phenomena, seeing even forms beyond the range of the eye of all beings, those behind walls and so forth, with the exceedingly pure fleshly eye. Knowing with the penetrating wisdom based on concentration that accomplishes one's own benefit, seeing with the teaching wisdom based on compassion that accomplishes the benefit of others.
Và nữa, Người biết rõ nhờ Túc mạng minh, Người thấy rõ nhờ Thiên nhãn minh. Nhờ Tam minh hay Lục thông, Người biết rõ, Người thấy rõ bằng Tuệ nhãn viên mãn, không bị ngăn ngại ở bất cứ đâu. Nhờ Trí tuệ có khả năng biết rõ tất cả các pháp, Người thấy rõ, bằng nhục nhãn thanh tịnh, ngay cả những sắc pháp ở sau vách tường, v.v., vượt quá tầm nhìn của nhãn căn của tất cả chúng sinh. Nhờ Tuệ giác chứng ngộ làm nền tảng cho Thiền định, có lợi ích cho tự thân, Người thấy rõ, nhờ Tuệ giác thuyết pháp làm nền tảng cho Đại bi, có lợi ích cho tha nhân.
Api ca pubbenivāsādīhi jānatā, dibbena cakkhunā passatā. Tīhi vijjāhi chahi vā pana abhiññāhi jānatā, sabbattha appaṭihatena samantacakkhunā passatā. Sabbadhammajānanasamatthāya vā paññāya jānatā, sabbasattānaṃ cakkhuvisayātītāni tirokuṭṭādigatānipi rūpāni ativisuddhena maṃsacakkhunā passatā. Attahitasādhikāya vā samādhipadaṭṭhānāya paṭivedhapaññāya jānatā, parahitasādhikāya karuṇāpadaṭṭhānāya desanāpaññāya passatā.
Because of destroying the enemies and because of being worthy of offerings and so forth, being an Arahant. Because of rightly and by himself understanding all phenomena, being a Perfectly Self-Enlightened One, or knowing the obstructing phenomena, seeing the leading-out phenomena, because of destroying the enemies of defilements, being an Arahant. Because of rightly and by himself understanding all phenomena, being a Perfectly Self-Enlightened One. Thus, extolled in four ways according to the four confidences, the various inclinations of beings, the various dispositions are thoroughly well-penetrated, as far as they are well, thoroughly penetrated.
Arahatā (A-la-hán), vì đã diệt trừ các kẻ thù (phiền não), và vì xứng đáng thọ nhận các vật dụng cúng dường. Sammāsambuddhena (Chánh Biến Tri), vì đã tự mình giác ngộ tất cả các pháp một cách đúng đắn, Người biết rõ các pháp chướng ngại đạo, Người thấy rõ các pháp đưa đến giải thoát, Arahatā (A-la-hán), vì đã diệt trừ các kẻ thù phiền não. Sammāsambuddhena (Chánh Biến Tri), vì đã tự mình giác ngộ tất cả các pháp một cách đúng đắn. Như vậy, với bốn Vô sở úy, Người tán thán bằng bốn cách, sự khác biệt về khuynh hướng, sự khác biệt về tùy miên của chúng sinh, được biết rất rõ ràng, cho đến mức được biết một cách hoàn hảo.
Arīnaṃ hatattā paccayādīnañca arahattā arahatā. Sammā sāmañca sabbadhammānaṃ buddhattā sammāsambuddhena antarāyikadhamme vā jānatā, niyyānikadhamme passatā, kilesārīnaṃ hatattā arahatā. Sammā sāmañca sabbadhammānaṃ buddhattā sammāsambuddhenāti. Evaṃ catūvesārajjavasena catūhākārehi thomitena sattānaṃ nānādhimuttikatā nānajjhāsayatā suppaṭividitā yāva ca suṭṭhu paṭividitā.
Now, to show the state of being thoroughly well-penetrated by him, he said "for this" and so on. This is what is said: And this, by the Blessed One, "Beings, bhikkhus, flow together, meet together according to their element, those of inferior disposition flow together, meet together with those of inferior disposition, those of beautiful disposition flow together, meet together with those of beautiful disposition. In the past time, bhikkhus, beings flowed together, met together according to their element, those of inferior disposition…etc… those of beautiful disposition flowed together, met together with those of beautiful disposition, in the future time, bhikkhus…etc… will flow together, will meet together, even now, bhikkhus, in the present time, beings flow together, meet together according to their element, those of inferior disposition…etc… those of beautiful disposition flow together, meet together with those of beautiful disposition", thus the various inclinations of beings, the various dispositions, the various views, the various beliefs, the various preferences, as if measuring with a measure, as if weighing with a scale, are known by the knowledge of various inclinations, by the knowledge of omniscience, that is as far as it is thoroughly well-penetrated. Even two beings with the same disposition are rare in the world. When one wants to go, another wants to stay, when one wants to drink, another wants to eat. And in these two, the teacher and the disciple, for this "the wanderer Suppiya…etc… they follow closely behind the Blessed One and the Saṅgha of bhikkhus". There, "and so on" means thus and so on, thus this, is the meaning. The rest is in the manner already stated.
Bây giờ, để cho thấy tính chất được biết rõ ràng này, Ngài nói "Ayañhi" (Bởi lẽ). Điều này có nghĩa là, Đức Thế Tôn đã nói: "Này các Tỳ-kheo, chúng sinh hòa hợp, tương ưng với nhau theo giới (yếu tố, khuynh hướng), những người có khuynh hướng thấp kém hòa hợp, tương ưng với những người có khuynh hướng thấp kém, những người có khuynh hướng tốt đẹp hòa hợp, tương ưng với những người có khuynh hướng tốt đẹp. Này các Tỳ-kheo, trong quá khứ, chúng sinh đã hòa hợp, tương ưng với nhau theo giới, những người có khuynh hướng thấp kém... những người có khuynh hướng tốt đẹp đã hòa hợp, tương ưng với nhau. Này các Tỳ-kheo, trong tương lai... sẽ hòa hợp, tương ưng, hiện tại, này các Tỳ-kheo, chúng sinh hòa hợp, tương ưng với nhau theo giới, những người có khuynh hướng thấp kém... những người có khuynh hướng tốt đẹp hòa hợp, tương ưng với nhau." Như vậy, sự khác biệt về khuynh hướng, sự khác biệt về tùy miên, sự khác biệt về kiến chấp, sự khác biệt về kham nhẫn, sự khác biệt về sở thích của chúng sinh, như đo bằng ống, như cân bằng cân, được biết rõ nhờ Trí tuệ về sự khác biệt về khuynh hướng, nhờ Nhất thiết chủng trí, cho đến mức được biết một cách hoàn hảo. Thật khó tìm thấy hai chúng sinh có cùng tùy miên trên đời. Khi một người muốn đi, một người muốn ở, khi một người muốn uống, một người muốn ăn. Và trong hai vị thầy trò này, "du sĩ ngoại đạo Suppiya... đi theo sau lưng Đức Thế Tôn và chúng Tỳ-kheo." Ở đó, itihameti, nghĩa là itiha ime, evaṃ ime (như thế này, như thế này). Phần còn lại như đã nói.
Idānissa suppaṭividitabhāvaṃ dassetuṃ ayañhītiādimāha. Idaṃ vuttaṃ hoti yā ca ayaṃ bhagavatā ‘‘dhātuso, bhikkhave, sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi saddhiṃ saṃsandanti samenti, kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samenti. Atītampi kho, bhikkhave, addhānaṃ dhātusova sattā saṃsandiṃsu samiṃsu, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandiṃsu samiṃsu, anāgatampi kho, bhikkhave, addhānaṃ…pe… saṃsandissanti samessanti, etarahipi kho, bhikkhave, paccuppannaṃ addhānaṃ dhātusova sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samentī’’ti evaṃ sattānaṃ nānādhimuttikatā, nānajjhāsayatā, nānādiṭṭhikatā, nānākhantitā, nānārucitā, nāḷiyā minantena viya tulāya tulayantena viya ca nānādhimuttikatāñāṇena sabbaññutaññāṇena viditā, sā yāva suppaṭividitā. Dvepi nāma sattā ekajjhāsayā dullabhā lokasmiṃ. Ekasmiṃ gantukāme eko ṭhātukāmo hoti, ekasmiṃ pivitukāme eko bhuñjitukāmo. Imesu cāpi dvīsu ācariyantevāsīsu ayañhi ‘‘suppiyo paribbājako…pe… bhagavantaṃ piṭṭhito piṭṭhito anubandhā honti bhikkhusaṅghañcā’’ti. Tattha itihameti itiha ime, evaṃ imeti attho. Sesaṃ vuttanayameva.
4. Then the Blessed One, having known this conversation of those monks, is here: having known means having known through the knowledge of omniscience. The Blessed One sometimes knows after seeing with his fleshly eye – as in “The Blessed One saw a great log being carried along by the current of the river Ganges” and so on (Saṃyutta Nikāya 4.241). Sometimes he knows after seeing with the divine eye – as in “The Blessed One, with the divine eye, purified and surpassing the human, saw those deities, even a thousand of them, taking possession of building sites in Pāṭaligāma” and so on (Dīgha Nikāya 2.152). Sometimes he knows after hearing with the normal ear – as in “The Blessed One heard this conversation of the venerable Ānanda with the wanderer Subhadda” and so on (Dīgha Nikāya 2.213). Sometimes he knows after hearing with the divine ear – as in “The Blessed One, with the divine ear element, purified and surpassing the human, heard this conversation of the householder Sandhāna with the wanderer Nigrodha” and so on (Dīgha Nikāya 3.54). Here, however, he knew after hearing with the knowledge of omniscience. Doing what did he know? The activity of the last watch, and activity is of two kinds, namely, meaningful and meaningless. Therein, meaningless activity was eradicated by the Blessed One at the Bodhi Tree itself through the path of Arahantship. But meaningful activity alone remains for the Blessed One. That is of five kinds – the activity before the meal, the activity after the meal, the activity of the first watch, the activity of the middle watch, and the activity of the last watch.
4. Rồi Đức Thế Tôn, sau khi biết việc tranh luận này của chư Tỳ-kheo ấy, ở đây, "sau khi biết" (viditvā) nghĩa là sau khi Ngài đã liễu tri bằng Nhất thiết chủng trí. Đức Thế Tôn ở một vài trường hợp, Ngài biết sau khi thấy bằng nhục nhãn – như trong câu, "Đức Thế Tôn đã thấy một khúc gỗ lớn đang trôi theo dòng sông Hằng" (S.iv,241). Ở một vài trường hợp, Ngài biết sau khi thấy bằng thiên nhãn – như trong câu, "Với thiên nhãn thanh tịnh siêu nhân, Đức Thế Tôn thấy chư thiên ấy đến hàng ngàn đang chọn lựa địa điểm xây dựng tại Pāṭaligāma (Ba-liên-phất)" (D.ii,152). Ở một vài trường hợp, Ngài biết sau khi nghe bằng nhĩ căn bình thường – như trong câu, "Đức Thế Tôn đã nghe được cuộc đối thoại này giữa Tôn giả Ānanda (A-nan) và du sĩ Subhadda (Tu-bạt-đà-la)" (D.ii,213). Ở một vài trường hợp, Ngài biết sau khi nghe bằng thiên nhĩ – như trong câu, "Với thiên nhĩ thanh tịnh siêu nhân, Đức Thế Tôn đã nghe được cuộc đối thoại này giữa gia chủ Sandhāna và du sĩ Nigrodha" (D.iii,54). Nhưng ở trường hợp này, Ngài đã liễu tri sau khi nghe bằng Nhất thiết chủng trí. Ngài đã liễu tri trong khi đang làm gì? Khi thực hiện phận sự cuối ngày, phận sự này có hai loại, có ý nghĩa và không có ý nghĩa. Trong hai loại này, phận sự không có ý nghĩa đã được Đức Thế Tôn đoạn tận bằng đạo A-la-hán ngay tại Bồ Đề Đạo Tràng. Còn phận sự của Đức Thế Tôn chỉ là phận sự có ý nghĩa. Phận sự đó có năm loại – phận sự trước giờ thọ thực, phận sự sau giờ thọ thực, phận sự trong canh đầu, phận sự trong canh giữa, và phận sự trong canh cuối.
4.Atha kho bhagavā tesaṃ bhikkhūnaṃ imaṃ saṅkhiyadhammaṃ viditvāti ettha viditvāti sabbaññutaññāṇena jānitvā. Bhagavā hi katthaci maṃsacakkhunā disvā jānāti – ‘‘addasā kho bhagavā mahantaṃ dārukkhandhaṃ gaṅgāya nadiyā sotena vuyhamāna’’ntiādīsu (saṃ. ni. 4.241) viya. Katthaci dibbacakkhunā disvā jānāti – ‘‘addasā kho bhagavā dibbena cakkhunā visuddhena atikkantamānusakena tā devatāyo sahassasseva pāṭaligāme vatthūni parigaṇhantiyo’’tiādīsu (dī. ni. 2.152) viya. Katthaci pakatisotena sutvā jānāti – ‘‘assosi kho bhagavā āyasmato ānandassa subhaddena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 2.213) viya. Katthaci dibbasotena sutvā jānāti – ‘‘assosi kho bhagavā dibbāya sotadhātuyā visuddhāya atikkantamānusikāya sandhānassa gahapatissa nigrodhena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 3.54) viya. Idha pana sabbaññutaññāṇena sutvā aññāsi. Kiṃ karonto aññāsi? Pacchimayāmakiccaṃ, kiccañca nāmetaṃ sātthakaṃ, niratthakanti duvidhaṃ hoti. Tattha niratthakakiccaṃ bhagavatā bodhipallaṅkeyeva arahattamaggena samugghātaṃ kataṃ. Sātthakaṃyeva pana bhagavato kiccaṃ hoti. Taṃ pañcavidhaṃ – purebhattakiccaṃ, pacchābhattakiccaṃ, purimayāmakiccaṃ, majjhimayāmakiccaṃ, pacchimayāmakiccanti.
Herein, this is the activity before the meal:
Trong các phận sự này, đây là phận sự trước giờ thọ thực -
Tatridaṃ purebhattakiccaṃ –
The Blessed One, rising early in the morning, for the sake of obliging his attendants and for the comfort of the body, having performed bodily care such as washing the face and so on, passes the time until the alms round in secluded sitting. At the time of the alms round, having dressed, fastened the waist-band, and arranged the outer robe, he takes his bowl and sometimes alone, sometimes surrounded by the Sangha of monks, enters a village or town for alms; sometimes in the normal way, sometimes with many miraculous displays occurring. For instance, as the world-protector enters for alms, gentle breezes go before him, cleaning the ground; clouds, releasing drops of water, settle the dust on the path and stand above as a canopy; other winds gather flowers and scatter them on the path; raised areas of ground become level, and low areas rise up; at the time of placing his foot, the ground becomes even; lotuses, giving a pleasant touch, receive his feet. As soon as the right foot is placed within the boundary post, rays of six colors emanate from his body, adorning palaces, peaked roofs, and so on, as if they were covered in gold and decorated with painted cloth, and they move here and there; elephants, horses, birds, and so on, remaining in their own places, make sounds in a sweet manner, as do musical instruments such as drums and lutes, and the ornaments worn by people. By that sign, people know: "Today the Blessed One has entered here for alms." Having dressed properly and well-covered, they leave their houses carrying incense, flowers, and so on, take to the streets, and reverently honor the Blessed One with incense, flowers, and so on, and having paid homage, they ask: "Give us, venerable sir, ten monks, give us twenty, fifty…up to…a hundred," and taking the Blessed One's bowl, they prepare seats and reverently serve him with alms food. The Blessed One, having finished his meal, observes the mental continuums of those beings and teaches the Dhamma in such a way that some establish themselves in the refuges, some in the five precepts, some in one or another of the fruits of stream-entry, once-returning, or non-returning; some, having gone forth, attain the highest fruit, Arahantship. Thus, having blessed the multitude, he rises from his seat and goes to the monastery. Having gone there, he sits on the excellent Buddha-seat prepared in the assembly hall, awaiting the completion of the monks' meal. Then, at the completion of the monks' meal, the attendant informs the Blessed One. Then the Blessed One enters the Perfumed Chamber. This, then, is the activity before the meal.
Đức Thế Tôn ngay khi trời vừa sáng, sau khi thực hiện các việc chăm sóc thân thể như rửa mặt và các việc khác để tạo sự thoải mái cho thân thể, và vì lợi ích cho các thị giả, Ngài trải qua thời gian ở một nơi thanh vắng cho đến giờ đi khất thực. Vào giờ khất thực, Ngài đắp y, thắt đai lưng, choàng thượng y, cầm bát, rồi Ngài đi vào làng hay thị trấn để khất thực, đôi khi đi một mình, đôi khi được Tăng đoàn Tỳ-kheo đi theo; đôi khi đi một cách bình thường, đôi khi với nhiều thần thông. Cụ thể là, khi bậc Đạo Sư đi vào làng để khất thực, những cơn gió nhẹ thổi phía trước dọn sạch con đường, những đám mây nhỏ xuống những giọt nước li ti làm lắng bụi trên đường, và đứng lại phía trên Ngài tạo thành một chiếc lọng. Những cơn gió khác mang những đóa hoa và rải chúng trên đường, những chỗ đất cao thì hạ xuống, những chỗ đất thấp thì nâng lên, mặt đất trở nên bằng phẳng vào lúc Ngài đặt chân xuống, những đóa hoa sen mềm mại chạm vào chân Ngài, đem lại cảm giác dễ chịu. Ngay khi bàn chân phải được đặt vào bên trong ngưỡng cửa (thành), sáu loại tia sáng phát ra từ thân Ngài, chạy qua lại, trang hoàng các lâu đài, các tòa nhà có nóc nhọn,v.v..., như thể chúng được phủ bằng vàng và được trang trí bằng những bức tranh. Voi, ngựa, chim, v.v..., vẫn đứng yên tại vị trí của chúng, cất lên âm thanh bằng một giọng du dương, cũng như trống, đàn, và các loại nhạc cụ khác, và đồ trang sức trên thân người. Bằng dấu hiệu đó, mọi người biết: "Hôm nay, Đức Thế Tôn đã đi vào đây để khất thực". Họ mặc y phục chỉnh tề, cầm hương, hoa và các thứ khác, ra khỏi nhà, đi ra đường, cung kính cúng dường Đức Thế Tôn bằng hương, hoa và các thứ khác, đảnh lễ, thỉnh cầu: "Bạch Thế Tôn, xin Ngài cho chúng con mười vị Tỳ-kheo, cho chúng con hai mươi vị, năm mươi vị,... cho đến... một trăm vị", nhận lấy bát của Đức Thế Tôn, chuẩn bị chỗ ngồi, cung kính dâng cúng vật thực. Đức Thế Tôn, sau khi thọ thực xong, quán sát tâm tư của những chúng sinh ấy, rồi thuyết pháp tương ứng, đến mức một số người an trú vào quy y Tam Bảo, một số vào năm giới, một số vào các Thánh quả Dự lưu, Nhất lai, Bất lai; một số xuất gia và đạt đến quả vị cao nhất, A-la-hán. Sau khi tế độ cho đại chúng như vậy, Ngài đứng dậy, rời khỏi chỗ ngồi và đi đến tinh xá. Đến nơi, Ngài ngồi trên bảo tọa đã được chuẩn bị trong sân điện, chờ đợi chư Tỳ-kheo thọ thực xong. Sau đó, khi chư Tỳ-kheo thọ thực xong, vị thị giả thông báo cho Đức Thế Tôn. Rồi Đức Thế Tôn đi vào hương thất. Đây là phận sự trước giờ thọ thực.
Bhagavā hi pātova uṭṭhāya upaṭṭhākānuggahatthaṃ sarīraphāsukatthañca mukhadhovanādisarīraparikammaṃ katvā yāva bhikkhācāravelā tāva vivittāsane vītināmetvā, bhikkhācāravelāyaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ pārupitvā pattamādāya kadāci ekako, kadāci bhikkhusaṅghaparivuto, gāmaṃ vā nigamaṃ vā piṇḍāya pavisati; kadāci pakatiyā, kadāci anekehi pāṭihāriyehi vattamānehi. Seyyathidaṃ, piṇḍāya pavisato lokanāthassa purato purato gantvā mudugatavātā pathaviṃ sodhenti, valāhakā udakaphusitāni muñcantā magge reṇuṃ vūpasametvā upari vitānaṃ hutvā tiṭṭhanti, apare vātā pupphāni upasaṃharitvā magge okiranti, unnatā bhūmippadesā onamanti, onatā unnamanti, pādanikkhepasamaye samāva bhūmi hoti, sukhasamphassāni padumapupphāni vā pāde sampaṭicchanti. Indakhīlassa anto ṭhapitamatte dakkhiṇapāde sarīrato chabbaṇṇarasmiyo nikkhamitvā suvaṇṇarasapiñjarāni viya citrapaṭaparikkhittāni viya ca pāsādakūṭāgārādīni alaṅkarontiyo ito cito ca dhāvanti, hatthiassavihaṅgādayo sakasakaṭṭhānesu ṭhitāyeva madhurenākārena saddaṃ karonti, tathā bherivīṇādīni tūriyāni manussānañca kāyūpagāni ābharaṇāni. Tena saññāṇena manussā jānanti – ‘‘ajja bhagavā idha piṇḍāya paviṭṭho’’ti. Te sunivatthā supārutā gandhapupphādīni ādāya gharā nikkhamitvā antaravīthiṃ paṭipajjitvā bhagavantaṃ gandhapupphādīhi sakkaccaṃ pūjetvā vanditvā – ‘‘amhākaṃ, bhante, dasa bhikkhū, amhākaṃ vīsati, paññāsaṃ…pe… sataṃ dethā’’ti yācitvā bhagavatopi pattaṃ gahetvā āsanaṃ paññapetvā sakkaccaṃ piṇḍapātena paṭimānenti. Bhagavā katabhattakicco tesaṃ sattānaṃ cittasantānāni oloketvā tathā dhammaṃ deseti, yathā keci saraṇagamanesu patiṭṭhahanti, keci pañcasu sīlesu, keci sotāpattisakadāgāmianāgāmiphalānaṃ aññatarasmiṃ; keci pabbajitvā aggaphale arahatteti. Evaṃ mahājanaṃ anuggahetvā uṭṭhāyāsanā vihāraṃ gacchati. Tattha gantvā maṇḍalamāḷe paññattavarabuddhāsane nisīdati, bhikkhūnaṃ bhattakiccapariyosānaṃ āgamayamāno. Tato bhikkhūnaṃ bhattakiccapariyosāne upaṭṭhāko bhagavato nivedeti. Atha bhagavā gandhakuṭiṃ pavisati. Idaṃ tāva purebhattakiccaṃ.
Then the Blessed One, having thus completed the activity before the meal, sitting in attendance in the Perfumed Chamber, having washed his feet, and stood on the footstool, instructs the Sangha of monks: "Monks, accomplish with diligence, rare is the arising of a Buddha in the world, rare is the attainment of human birth, rare is auspiciousness, rare is the going forth, rare is the hearing of the true Dhamma." Therein, some ask the Blessed One for a meditation subject. The Blessed One gives them a meditation subject suitable to their temperament. Then, all of them, having paid homage to the Blessed One, go to their own respective places for the night and for the day. Some go to the forest, some to the foot of a tree, some to one or another of the mountains and so on, some to the realm of the Four Great Kings…some to the realm of Vasavatti. Then the Blessed One, entering the Perfumed Chamber, if he wishes, lies down on his right side, mindful and clearly aware, for a moment in the lion's posture. Then, having rested his body, he rises and in the second part surveys the world. In the third part, the multitude in the village or town near which he is dwelling, having given alms in the morning, in the afternoon, well-dressed and well-covered, carrying incense, flowers, and so on, gather at the monastery. Then the Blessed One, with a suitable miraculous display for the assembly that has arrived, goes to the Dhamma hall and, sitting on the excellent Buddha-seat that has been prepared, teaches the Dhamma that is timely and relevant. Then, knowing the time, he dismisses the assembly. The people pay homage to the Blessed One and depart. This is the activity after the meal.
Rồi, Đức Thế Tôn sau khi hoàn tất phận sự trước giờ thọ thực như vậy, sau khi rửa chân tại nơi đặt chân trong hương thất, Ngài ngồi xuống và ban lời giáo huấn cho Tăng đoàn Tỳ-kheo: "Này chư Tỳ-kheo, hãy tinh tấn thành tựu bằng sự không phóng dật, sự xuất hiện của một vị Phật là hy hữu ở đời, được thân người là hy hữu, đầy đủ các điều kiện là hy hữu, xuất gia là hy hữu, được nghe diệu pháp là hy hữu". Ở đó, một số vị thỉnh vấn Đức Thế Tôn về đề mục thiền quán. Đức Thế Tôn ban cho họ đề mục thiền quán phù hợp với căn tánh của họ. Rồi tất cả đảnh lễ Đức Thế Tôn, đi đến chỗ ở của mình vào ban ngày và ban đêm. Một số đi vào rừng, một số đến gốc cây, một số đến các ngọn núi, v.v..., một số đến cõi trời Tứ Thiên Vương,... một số đến cõi trời Đao Lợi. Sau đó, Đức Thế Tôn đi vào hương thất, và nếu muốn, Ngài nằm xuống bằng hông bên phải, tỉnh giác, chánh niệm trong một khoảng thời gian ngắn theo thế nằm của sư tử. Rồi, sau khi thân thể đã được thư giãn, Ngài đứng dậy và trong phần thứ hai, Ngài quán sát thế gian. Trong phần thứ ba, ở tại làng hay thị trấn mà Ngài đang cư trú, đại chúng sau khi cúng dường vật thực trước giờ trưa, sau giờ trưa họ mặc y phục chỉnh tề, mang theo hương, hoa và các thứ khác, rồi tụ tập tại tinh xá. Rồi, Đức Thế Tôn đi đến với đại chúng bằng thần thông tương xứng, Ngài ngồi trên bảo tọa đã được chuẩn bị trong pháp đường, thuyết pháp đúng thời, đúng lúc, rồi sau khi biết đã đúng thời, Ngài giải tán đại chúng, mọi người đảnh lễ Đức Thế Tôn và ra về. Đây là phận sự sau giờ thọ thực.
Atha bhagavā evaṃ katapurebhattakicco gandhakuṭiyā upaṭṭhāne nisīditvā pāde pakkhāletvā pādapīṭhe ṭhatvā bhikkhusaṅghaṃ ovadati – ‘‘bhikkhave, appamādena sampādetha, dullabho buddhuppādo lokasmiṃ, dullabho manussattapaṭilābho, dullabhā sampatti, dullabhā pabbajjā, dullabhaṃ saddhammassavana’’nti. Tattha keci bhagavantaṃ kammaṭṭhānaṃ pucchanti. Bhagavāpi tesaṃ cariyānurūpaṃ kammaṭṭhānaṃ deti. Tato sabbepi bhagavantaṃ vanditvā attano attano rattiṭṭhānadivāṭṭhānāni gacchanti. Keci araññaṃ, keci rukkhamūlaṃ, keci pabbatādīnaṃ aññataraṃ, keci cātumahārājikabhavanaṃ…pe… keci vasavattibhavananti. Tato bhagavā gandhakuṭiṃ pavisitvā sace ākaṅkhati, dakkhiṇena passena sato sampajāno muhuttaṃ sīhaseyyaṃ kappeti. Atha samassāsitakāyo vuṭṭhahitvā dutiyabhāge lokaṃ voloketi. Tatiyabhāge yaṃ gāmaṃ vā nigamaṃ vā upanissāya viharati tattha mahājano purebhattaṃ dānaṃ datvā pacchābhattaṃ sunivattho supāruto gandhapupphādīni ādāya vihāre sannipatati. Tato bhagavā sampattaparisāya anurūpena pāṭihāriyena gantvā dhammasabhāyaṃ paññattavarabuddhāsane nisajja dhammaṃ deseti kālayuttaṃ samayayuttaṃ, atha kālaṃ viditvā parisaṃ uyyojeti, manussā bhagavantaṃ vanditvā pakkamanti. Idaṃ pacchābhattakiccaṃ.
Having thus completed the activity after the meal, if he wishes to bathe his limbs, he rises from the Buddha-seat and, entering the bathing room, has his limbs bathed with water prepared by the attendant. The attendant also brings the Buddha-seat and sets it up in the area of the Perfumed Chamber. The Blessed One, having dressed in a red double-layered cloth, fastened the waist-band, and arranged the upper robe over one shoulder, goes there and sits alone for a moment in seclusion. Then the monks come from here and there to attend upon the Blessed One. Therein, some ask questions, some ask for a meditation subject, some request the teaching of the Dhamma. The Blessed One, fulfilling their intentions, passes the first watch. This is the activity of the first watch.
Sau khi đã hoàn tất phận sự sau giờ thọ thực như vậy, nếu Ngài muốn tắm, Ngài đứng dậy khỏi chỗ ngồi, đi vào phòng tắm, và để cho thị giả xối nước đã được chuẩn bị lên thân thể. Vị thị giả cũng mang bảo tọa đến và đặt tại sân hương thất. Đức Thế Tôn mặc y phục hai lớp màu đỏ, thắt đai lưng, đắp thượng y một bên vai, rồi đến đó ngồi một mình, nhập vào thiền định trong một khoảng thời gian ngắn, rồi chư Tỳ-kheo từ khắp nơi đến hầu Đức Thế Tôn. Trong đó, một số vị thỉnh vấn, một số vị thỉnh cầu đề mục thiền quán, một số vị thỉnh cầu được nghe pháp. Đức Thế Tôn, làm thỏa mãn ý nguyện của họ, trải qua canh đầu. Đây là phận sự trong canh đầu.
So evaṃ niṭṭhitapacchābhattakicco sace gattāni osiñcitukāmo hoti, buddhāsanā vuṭṭhāya nhānakoṭṭhakaṃ pavisitvā upaṭṭhākena paṭiyāditaudakena gattāni utuṃ gaṇhāpeti. Upaṭṭhākopi buddhāsanaṃ ānetvā gandhakuṭipariveṇe paññapeti. Bhagavā surattadupaṭṭaṃ nivāsetvā kāyabandhanaṃ bandhitvā uttarāsaṅgaṃ ekaṃsaṃ karitvā tattha gantvā nisīdati ekakova muhuttaṃ paṭisallīno, atha bhikkhū tato tato āgamma bhagavato upaṭṭhānaṃ āgacchanti. Tattha ekacce pañhaṃ pucchanti, ekacce kammaṭṭhānaṃ, ekacce dhammassavanaṃ yācanti. Bhagavā tesaṃ adhippāyaṃ sampādento purimayāmaṃ vītināmeti. Idaṃ purimayāmakiccaṃ.
At the end of the activity of the first watch, when the monks have paid homage to the Blessed One and departed, the deities of the entire ten-thousand world system, finding an opportunity, approach the Blessed One and ask questions, down to the last four syllables, according to their individual capacity. The Blessed One, answering the questions of those deities, passes the middle watch. This is the activity of the middle watch.
Sau khi kết thúc phận sự trong canh đầu, khi chư Tỳ-kheo đã đảnh lễ Đức Thế Tôn và ra về, chư thiên từ khắp mười ngàn thế giới, có được cơ hội, đến gặp Đức Thế Tôn và thỉnh vấn, dù ít nhất là bốn chữ, theo như ước muốn của họ. Đức Thế Tôn, giải đáp câu hỏi của chư thiên ấy, trải qua canh giữa. Đây là phận sự trong canh giữa.
Purimayāmakiccapariyosāne pana bhikkhūsu bhagavantaṃ vanditvā pakkantesu sakaladasasahassilokadhātudevatāyo okāsaṃ labhamānā bhagavantaṃ upasaṅkamitvā pañhaṃ pucchanti, yathābhisaṅkhataṃ antamaso caturakkharampi. Bhagavā tāsaṃ devatānaṃ pañhaṃ vissajjento majjhimayāmaṃ vītināmeti. Idaṃ majjhimayāmakiccaṃ.
Then, dividing the last watch into three portions, he passes one portion walking in meditation to relieve the bodily fatigue caused by sitting since before the meal. In the second portion, entering the Perfumed Chamber, he lies down on his right side, mindful and clearly aware, in the lion's posture. In the third portion, rising and sitting, he surveys the world with the Buddha-eye to see those individuals who have made merit under former Buddhas through giving, virtue, and so on. This is the activity of the last watch.
Sau đó, chia canh cuối thành ba phần, Ngài trải qua một phần để đi kinh hành nhằm giải trừ sự mệt mỏi của thân thể vì đã ngồi từ trước giờ thọ thực. Trong phần thứ hai, Ngài đi vào hương thất, nằm xuống bằng hông bên phải, tỉnh giác, chánh niệm theo thế nằm của sư tử. Trong phần thứ ba, Ngài thức dậy, ngồi xuống và quán sát thế gian bằng Phật nhãn để thấy những người đã tạo công đức lớn với các vị Phật quá khứ bằng bố thí, trì giới, v.v... Đây là phận sự trong canh cuối.
Pacchimayāmaṃ pana tayo koṭṭhāse katvā purebhattato paṭṭhāya nisajjāya pīḷitassa sarīrassa kilāsubhāvamocanatthaṃ ekaṃ koṭṭhāsaṃ caṅkamena vītināmeti. Dutiyakoṭṭhāse gandhakuṭiṃ pavisitvā dakkhiṇena passena sato sampajāno sīhaseyyaṃ kappeti. Tatiyakoṭṭhāse paccuṭṭhāya nisīditvā purimabuddhānaṃ santike dānasīlādivasena katādhikārapuggaladassanatthaṃ buddhacakkhunā lokaṃ voloketi. Idaṃ pacchimayāmakiccaṃ.
On that day, the Blessed One, having completed the activity before the meal in Rājagaha and having come to the road in the afternoon, having taught the monks a meditation subject in the first watch, having answered the questions of the deities in the middle watch, and in the last watch, having ascended to the walking path and while walking, he heard, with the knowledge of omniscience itself, this conversation of the five hundred monks which had arisen concerning the knowledge of omniscience. Therefore, it is said: "Doing the activity of the last watch, he knew."
Vào ngày hôm đó, Đức Thế Tôn sau khi hoàn tất phận sự trước giờ thọ thực tại Rājagaha (Vương Xá thành), đã đi đến con đường sau giờ thọ thực, ban đề mục thiền quán cho chư Tỳ-kheo trong canh đầu, giải đáp câu hỏi của chư thiên trong canh giữa, và trong canh cuối, Ngài bước lên đường kinh hành, trong khi đang đi kinh hành, Ngài đã nghe cuộc nói chuyện của năm trăm Tỳ-kheo ấy về Nhất thiết chủng trí bằng chính Nhất thiết chủng trí. Vì vậy, nói rằng: "Ngài đã liễu tri trong khi đang làm phận sự cuối ngày".
Tasmiṃ pana divase bhagavā purebhattakiccaṃ rājagahe pariyosāpetvā pacchābhatte maggaṃ āgato, purimayāme bhikkhūnaṃ kammaṭṭhānaṃ kathetvā, majjhimayāme devatānaṃ pañhaṃ vissajjetvā, pacchimayāme caṅkamaṃ āruyha caṅkamamāno pañcannaṃ bhikkhusatānaṃ imaṃ sabbaññutaññāṇaṃ ārabbha pavattaṃ kathaṃ sabbaññutaññāṇeneva sutvā aññāsīti. Tena vuttaṃ – ‘‘pacchimayāmakiccaṃ karonto aññāsī’’ti.
And it occurred to him, having known this: "These monks are speaking of my qualities with reference to my Omniscience, but the function of Omniscience is not clear to them, it is clear only to me. When I have departed, they will continue their discussion uninterruptedly. Then, for their sake, having established the occasion for that, dividing morality into three types, roaring the lion's roar unshakeable in sixty-two positions, bringing together the causal conditions, making evident the qualities of the Buddha, as if lifting up Mount Sineru, as if striking the sky with a golden peak, and causing the ten-thousand-world-system to tremble, I shall teach the Brahmajāla Sutta, concluding with the pinnacle of Arahantship. That teaching of mine, even after my Parinibbana, will, for five thousand years, lead beings to the great, deathless Nibbana." Having thus considered, he approached the circular hall. "Where" means in which direction it was necessary to approach. Or this is an instrumental case in the sense of a locative: the meaning here is that he went to the place where the circular hall was.
Và điều này đã khởi lên trong Ngài sau khi quán xét – "Những vị Tỳ kheo này đang nói lên những phẩm chất liên quan đến trí tuệ toàn giác của ta, nhưng đối với họ, nhiệm vụ của trí tuệ toàn giác vẫn chưa rõ ràng, mà chỉ rõ ràng đối với ta. Tuy nhiên, khi ta đi rồi, những vị này sẽ tiếp tục câu chuyện của họ không gián đoạn, sau đó, làm cho nguyên nhân phát sinh của câu chuyện đó (trở nên rõ ràng), ta sẽ giảng giải ba loại giới, rống tiếng rống sư tử không thể bị đánh bại ở sáu mươi hai nơi, thiết lập (giải thích) các duyên hệ, làm hiển lộ những phẩm chất của Đức Phật, như thể nhấc bổng núi Tu Di (Sineru), như thể đánh vào hư không bằng đỉnh núi bằng vàng, và làm cho mười ngàn thế giới rung chuyển, ta sẽ thuyết giảng kinh Brahmajāla (Phạm Võng), với đỉnh cao là quả vị A La Hán. Bài giảng đó của ta, ngay cả sau khi ta nhập Niết Bàn, vẫn sẽ có khả năng đưa chúng sanh đến Niết Bàn Đại Bất Tử trong năm ngàn năm". Sau khi suy nghĩ như vậy, ngài đi đến Mạn Đà La Đường ( मंडलामळ). "Yena" (nơi mà) nghĩa là hướng mà, nơi cần đến. Hoặc từ này ở trong nghĩa vị trí cách (bhummatthe) là "ở nơi nào". Ý nghĩa ở đây là, ở nơi nào có Mạn Đà La Đường, ngài đã đi đến đó.
Ñatvā ca panassa etadahosi – ‘‘ime bhikkhū mayhaṃ sabbaññutaññāṇaṃ ārabbha guṇaṃ kathenti, etesañca sabbaññutaññāṇakiccaṃ na pākaṭaṃ, mayhameva pākaṭaṃ. Mayi pana gate ete attano kathaṃ nirantaraṃ ārocessanti, tato nesaṃ ahaṃ taṃ aṭṭhuppattiṃ katvā tividhaṃ sīlaṃ vibhajanto, dvāsaṭṭhiyā ṭhānesu appaṭivattiyaṃ sīhanādaṃ nadanto, paccayākāraṃ samodhānetvā buddhaguṇe pākaṭe katvā, sineruṃ ukkhipento viya suvaṇṇakūṭena nabhaṃ paharanto viya ca dasasahassilokadhātukampanaṃ brahmajālasuttantaṃ arahattanikūṭena niṭṭhāpento desessāmi, sā me desanā parinibbutassāpi pañcavassasahassāni sattānaṃ amatamahānibbānaṃ sampāpikā bhavissatī’’ti. Evaṃ cintetvā yena maṇḍalamāḷo tenupasaṅkamīti . Yenāti yena disābhāgena, so upasaṅkamitabbo. Bhummatthe vā etaṃ karaṇavacanaṃ, yasmiṃ padese so maṇḍalamāḷo, tattha gatoti ayamettha attho.
He sat down on the prepared seat. In the time of the Buddha, it is said, wherever even one monk dwelt, a Buddha-seat was always prepared. Why? The Blessed One, it is said, having given a meditation subject in his presence, considers those dwelling in a suitable place: “So-and-so has gone having taken a meditation subject in my presence; will he be able to bring about distinction, or not?” Then he sees him abandoning the meditation subject and thinking unwholesome thoughts. Then: "How indeed, while dwelling having taken a meditation subject in the presence of a Teacher like me, will unwholesome thoughts overwhelm this good son and cause him to wander in the round of suffering that has no discernible beginning?" For his benefit, manifesting himself right there, having advised that good son, he rises up into the sky and goes back to his own dwelling place. Then, being thus advised, those monks thought: "The Teacher, having known our minds, came and showed himself as if standing right near us." At that moment, "Venerable Sir, sit here, sit here" -- searching for a seat is a burden. They dwell having prepared a seat. He who has a stool, prepares that. He who does not, prepares a couch, or a plank, or a piece of wood, or a stone, or a heap of sand. Failing to obtain those, they gather even old leaves and spread out a refuse-rag there. Here, however, there is only the king's sitting place; having dusted it off and prepared it, surrounding it, those monks sat praising his qualities with reference to the knowledge in which the Blessed One has full confidence. Referring to that, it is said: "He sat down on the prepared seat".
Ngài ngồi xuống trên chỗ ngồi đã được chuẩn bị (paññatte āsane nisīdi). Tương truyền, vào thời Đức Phật, bất cứ nơi nào, dù chỉ có một vị Tỳ kheo trú ngụ, chỗ ngồi của Đức Phật luôn được chuẩn bị sẵn. Tại sao? Tương truyền, Đức Thế Tôn, sau khi nhận đề mục nghiệp xứ (kammaṭṭhānaṃ) gần ngài, khi trú ngụ ở nơi thích hợp, ngài suy nghĩ – "Vị kia đã nhận đề mục nghiệp xứ gần ta và ra đi, liệu vị ấy có thể đạt được sự thù thắng hay không?". Sau đó, ngài thấy vị ấy từ bỏ đề mục nghiệp xứ và suy nghĩ những tư tưởng bất thiện, rồi (ngài nghĩ) "Làm sao mà thiện nam tử này, sau khi nhận đề mục nghiệp xứ gần vị Đạo Sư như ta, lại bị những tư tưởng bất thiện chinh phục và trôi lăn trong những khổ đau của vòng luân hồi vô tận?". Vì lòng thương tưởng vị ấy, ngay tại đó, ngài hiện thân, khuyên dạy thiện nam tử đó, rồi bay lên hư không, trở về trú xứ của mình. Sau khi được khuyên dạy như vậy, các vị Tỳ kheo suy nghĩ – "Đức Đạo Sư, biết được tâm của chúng ta, đã đến và hiện thân ngay trước mặt chúng ta". Lúc đó – "Bạch ngài, xin ngài ngồi đây, xin ngài ngồi đây", việc tìm kiếm chỗ ngồi trở thành một gánh nặng. Họ chuẩn bị sẵn chỗ ngồi và trú ngụ. Vị nào có ghế dài (pīṭhaṃ), vị ấy chuẩn bị nó. Vị nào không có, chuẩn bị giường, tấm ván, khúc gỗ, tảng đá, hoặc đống cát. Những ai không có được những thứ đó, gom lá cây cũ, trải y tăng già lê (paṃsukūlaṃ) lên đó và đặt xuống. Nhưng ở đây, có chỗ ngồi của vua, sau khi phủi bụi và chuẩn bị, vây quanh nó, các vị Tỳ kheo, bắt đầu tán dương những phẩm chất liên quan đến trí tuệ siêu việt của Đức Thế Tôn, và ngồi xuống. Liên quan đến điều đó, có nói – "Ngài ngồi xuống trên chỗ ngồi đã được chuẩn bị".
Paññatte āsane nisīdīti buddhakāle kira yattha yattha ekopi bhikkhu viharati sabbattha buddhāsanaṃ paññattameva hoti. Kasmā? Bhagavā kira attano santike kammaṭṭhānaṃ gahetvā phāsukaṭṭhāne viharante manasi karoti – ‘‘asuko mayhaṃ santike kammaṭṭhānaṃ gahetvā gato, sakkhissati nu kho visesaṃ nibbattetuṃ no vā’’ti. Atha naṃ passati kammaṭṭhānaṃ vissajjetvā akusalavitakkaṃ vitakkayamānaṃ, tato ‘‘kathañhi nāma mādisassa satthu santike kammaṭṭhānaṃ gahetvā viharantaṃ imaṃ kulaputtaṃ akusalavitakkā abhibhavitvā anamatagge vaṭṭadukkhe saṃsāressantī’’ti tassa anuggahatthaṃ tattheva attānaṃ dassetvā taṃ kulaputtaṃ ovaditvā ākāsaṃ uppatitvā puna attano vasanaṭṭhānameva gacchati. Athevaṃ ovadiyamānā te bhikkhū cintayiṃsu – ‘‘satthā amhākaṃ manaṃ jānitvā āgantvā amhākaṃ samīpe ṭhitaṃyeva attānaṃ dasseti’’. Tasmiṃ khaṇe – ‘‘bhante, idha nisīdatha, idha nisīdathā’’ti āsanapariyesanaṃ nāma bhāroti. Te āsanaṃ paññapetvāva viharanti. Yassa pīṭhaṃ atthi, so taṃ paññapeti. Yassa natthi, so mañcaṃ vā phalakaṃ vā kaṭṭhaṃ vā pāsāṇaṃ vā vālukapuñjaṃ vā paññapeti. Taṃ alabhamānā purāṇapaṇṇānipi saṅkaḍḍhitvā tattha paṃsukūlaṃ pattharitvā ṭhapenti. Idha pana rañño nisīdanāsanameva atthi, taṃ papphoṭetvā paññapetvā parivāretvā te bhikkhū bhagavato adhimuttikañāṇamārabbha guṇaṃ thomayamānā nisīdiṃsu. Taṃ sandhāya vuttaṃ – ‘‘paññatte āsane nisīdī’’ti.
Having thus sat down, even though knowing, he asked the monks in order to initiate the discussion. And they told him everything. Therefore, it is said: "Having sat down, the Blessed One" and so on. "With what now" means, with what discussion are you gathered? There is also the reading, “What now” meaning, with what discussion are you here? There is even the reading, “What then”, the meaning of which is the same as the previous one.
Sau khi ngồi xuống như vậy, mặc dù đã biết, ngài vẫn hỏi các Tỳ kheo để khơi dậy câu chuyện. Và họ đã kể cho ngài nghe tất cả. Vì vậy, có nói – "Sau khi ngồi xuống, Đức Thế Tôn..." và tiếp theo. Ở đó "kāya nutthāti" nghĩa là các vị đang ngồi với câu chuyện gì? "Kāya netthāti" cũng là một bản পাঠ (pāḷi), nghĩa của nó là "với câu chuyện gì ở đây?". "Kāya notthātipi" cũng là một bản পাঠ. Ý nghĩa của nó cũng giống như trước.
Evaṃ nisinno pana jānantoyeva kathāsamuṭṭhāpanatthaṃ bhikkhū pucchi. Te cassa sabbaṃ kathayiṃsu. Tena vuttaṃ – ‘‘nisajja kho bhagavā’’tiādi. Tattha kāya nutthāti katamāya nu kathāya sannisinnā bhavathāti attho. Kāya netthātipi pāḷi, tassā katamāya nu etthāti attho kāya notthātipi pāḷi. Tassāpi purimoyeva attho.
An incidental discussion means a discussion other than meditation practice, reflection, instruction, or questioning. Interrupted means not completed, not having reached its culmination, because of my arrival. What does he show by that? “I have not come to interrupt your discussion; rather, I have come, because of my Omniscience, to complete your discussion for you, having brought it to a head.” Having sat down, he offers the Omniscient's offering. This now, Venerable Sir, is our incidental discussion, interrupted, and the Blessed One has arrived, the meaning here is also this: This, venerable sir, is our unfinished discussion on the quality of the Blessed One regarding the knowledge of Omniscience, not some worldly prattle like talk of kings and so on, and the Blessed One has arrived; now complete it for us and teach.
Câu chuyện giữa chừng (Antarākathā) nghĩa là, một câu chuyện khác giữa chừng của việc ghi nhớ đề mục nghiệp xứ, việc tụng đọc và việc hỏi han, và những việc khác. "Vippakatāti" nghĩa là, do sự xuất hiện của ta mà chưa hoàn thành, chưa đạt đến đỉnh cao. Điều đó cho thấy điều gì? "Ta không đến để làm gián đoạn câu chuyện của các vị, mà ta đến để hoàn thành câu chuyện của các vị với trí tuệ toàn giác, làm cho nó đạt đến đỉnh cao và trình bày nó", ngay khi ngồi xuống, ngài đã tuyên bố sự bảo hộ của bậc toàn giác. "Ayaṃ kho no, bhante, antarākathā vippakatā, atha bhagavā anuppattoti" (Bạch ngài, đây là câu chuyện giữa chừng của chúng con, chưa hoàn tất, thì Đức Thế Tôn đã đến) ở đây cũng có ý nghĩa này. Bạch ngài, câu chuyện tán dương những phẩm chất liên quan đến trí tuệ toàn giác của Đức Thế Tôn này của chúng con chưa hoàn tất, không phải là câu chuyện thế tục về vua chúa, v.v., thì Đức Thế Tôn đã đến; bây giờ, xin ngài hãy hoàn thành nó và giảng dạy.
Antarākathāti , kammaṭṭhānamanasikārauddesaparipucchādīnaṃ antarā aññā ekā kathā. Vippakatāti, mama āgamanapaccayā apariniṭṭhitā sikhaṃ appattā. Tena kiṃ dasseti? ‘‘Nāhaṃ tumhākaṃ kathābhaṅgatthaṃ āgato, ahaṃ pana sabbaññutāya tumhākaṃ kathaṃ niṭṭhāpetvā matthakappattaṃ katvā dassāmīti āgato’’ti nisajjeva sabbaññupavāraṇaṃ pavāreti. Ayaṃ kho no, bhante, antarākathā vippakatā , atha bhagavā anuppattoti etthāpi ayamadhippāyo. Ayaṃ bhante amhākaṃ bhagavato sabbaññutaññāṇaṃ ārabbha guṇakathā vippakatā, na rājakathādikā tiracchānakathā, atha bhagavā anuppatto; taṃ no idāni niṭṭhāpetvā desethāti.
And to this extent, that which was spoken by the venerable Ananda is like a landing-place with a clear area of white lotuses and water lilies, with the pure, sweet water of a pond for easy descent, with a design of smooth stone slabs making an exquisite flight of jeweled steps, with a spread of white sand like a scattered heap of pearls, a well-arranged wall, decorated with elaborate cornices, as if desiring to touch the starry path, a magnificent palace towering aloft, a stairway for ascending easily, made of ivory, with smooth, soft planks, decorated with golden vines and radiant with the splendor of many jewels, an opulent mansion frequented by household members whose speech is mingled with the sounds of golden bangles, anklets, and so forth, melodious with laughter, and adorned with abundant wealth, a great doorway with wide doorjambs, well-placed, for easy entry, radiant with the effulgence of gold, silver, jewels, pearls, coral, and so forth, for easy comprehension of this Sutta, indicative of the excellence of the Buddha's qualities, complete with meaning and expression, the introduction adorned with reference to the time, place, teacher, individual, assembly, and statement, the exposition of its meaning is complete.
Và cho đến đây, là phần giải thích ý nghĩa của phần mở đầu (nidānaṃ) đã được Tôn giả Ānanda trình bày, như thể là một bến nước trong một hồ sen trong vắt, nước ngọt ngào, trong lành, với những bậc thang bằng đá trong sạch, trang trí công phu, để dễ dàng xuống (hồ); như thể là một dải đất bằng phẳng màu trắng, rải đầy cát giống như ngọc trai rải rác, của một ngôi đền (tịnh xá) được trang hoàng bằng những bức tường được phân chia rõ ràng và những hàng rào trang trí công phu, như thể muốn chạm đến con đường của các vì sao; như thể là một cầu thang lộng lẫy, được trang trí bằng ngà voi, những tấm ván mềm mại và mịn màng, được bao bọc bởi những dây leo bằng vàng, tỏa sáng với ánh sáng của những viên ngọc quý, để dễ dàng lên một lâu đài cao vút, đang vươn mình; và như thể là một cánh cổng lớn, với những trụ cổng rộng rãi, được trang trí bằng vàng, bạc, ngọc bích, ngọc trai, san hô, v.v., vững chắc, để dễ dàng đi vào một ngôi nhà lớn lộng lẫy, sang trọng, nơi những người trong nhà đi lại, với âm thanh ngọt ngào của tiếng cười nói hòa quyện với âm thanh va chạm của vòng vàng, vòng chân, v.v., phần mở đầu này, được trang hoàng bằng những chỉ dẫn về thời gian, địa điểm, người nói, đối tượng, hội chúng, v.v., để dễ dàng hiểu được bài kinh này, bài kinh chỉ ra những ảnh hưởng của những phẩm chất của Đức Phật, đầy đủ cả ý nghĩa và văn cú.
Ettāvatā ca yaṃ āyasmatā ānandena kamalakuvalayujjalavimalasādhurasasalilāya pokkharaṇiyā sukhāvataraṇatthaṃ nimmalasilātalaracanavilāsasobhitaratanasopānaṃ, vippakiṇṇamuttātalasadisavālukākiṇṇapaṇḍarabhūmibhāgaṃ titthaṃ viya suvibhattabhittivicitravedikāparikkhittassa nakkhattapathaṃ phusitukāmatāya viya, vijambhitasamussayassa pāsādavarassa sukhārohaṇatthaṃ dantamayasaṇhamuduphalakakañcanalatāvinaddhamaṇigaṇappabhāsamudayujjalasobhaṃ sopānaṃ viya, suvaṇṇavalayanūpurādisaṅghaṭṭanasaddasammissitakathitahasitamadhurassaragehajanavicaritassa uḷārissarivibhavasobhitassa mahāgharassa sukhappavesanatthaṃ suvaṇṇarajatamaṇimuttapavāḷādijutivissaravijjotitasuppatiṭṭhitavisāladvārabāhaṃ mahādvāraṃ viya ca atthabyañjanasampannassa buddhaguṇānubhāvasaṃsūcakassa imassa suttassa sukhāvagahaṇatthaṃ kāladesadesakavatthuparisāpadesapaṭimaṇḍitaṃ nidānaṃ bhāsitaṃ, tassatthavaṇṇanā samattāti.
5. Now, the opportunity has arrived for the exposition of the Sutta, set forth by the Blessed One with the method beginning, "Others, monks, might speak dispraise of me." And this is the exposition of the Sutta. Since it becomes clear when explained after examining the setting forth of the Sutta, therefore we will first examine the setting forth of the Sutta. There are four settings forth of a Sutta: his own inclination, the inclination of others, prompted by a question, and occasioned by a situation.
5. Bây giờ – là lúc thích hợp để giải thích bài kinh được Đức Thế Tôn đưa ra với câu "Này các Tỳ kheo, nếu những người khác nói xấu ta..." và tiếp theo. Tuy nhiên, đó là sự giải thích bài kinh. Vì sự giải thích bài kinh trở nên rõ ràng khi được trình bày sau khi xem xét việc đưa ra bài kinh, nên trước tiên chúng ta sẽ xem xét việc đưa ra bài kinh. Có bốn cách đưa ra bài kinh – do tự ý mình (attajjhāsayo), do ý của người khác (parajjhāsayo), do câu hỏi (pucchāvasiko), và do nhân duyên phát sinh (aṭṭhuppattikoti).
5. Idāni – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’ntiādinā nayena bhagavatā nikkhittassa suttassa vaṇṇanāya okāso anuppatto. Sā panesā suttavaṇṇanā. Yasmā suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hoti, tasmā suttanikkhepaṃ tāva vicārayissāma. Cattāro hi suttanikkhepā – attajjhāsayo, parajjhāsayo, pucchāvasiko, aṭṭhuppattikoti.
Among them, those Suttas which the Blessed One spoke, unprompted by others, solely from his own inclination, such as the Ākaṅkheyya Sutta, the Vattha Sutta, the Mahāsatipaṭṭhāna Sutta, the Mahāsaḷāyatana Vibhaṅga Sutta, the Ariyavaṃsa Sutta, the Sammappadhāna Sutta discourse, the Iddhipāda, Indriya, Bala, Bojjhaṅga, Maggaṅga Sutta discourses, and so forth, their setting forth is from his own inclination.
Trong đó, những bài kinh nào mà Đức Thế Tôn đã giảng, không do người khác thỉnh cầu, mà chỉ do ý của chính ngài; ví dụ như, kinh Ākaṅkheyya (kinh Ước Nguyện), kinh Vattha (kinh Ví Dụ Tấm Vải), kinh Mahāsatipaṭṭhāna (kinh Đại Niệm Xứ), kinh Mahāsaḷāyatanavibhaṅga (kinh Đại Sáu Xứ), kinh Ariyavaṃsa (kinh Thánh Chủng), kinh Sammappadhāna (Chánh Tinh Tấn), các bài kinh về các chi phần của Iddhipāda (Thần Túc), Indriya (Căn), Bala (Lực), Bojjhaṅga (Giác Chi), Maggaṅga (Đạo Chi), và những bài kinh tương tự; việc đưa ra những bài kinh đó là do tự ý mình.
Tattha yāni suttāni bhagavā parehi anajjhiṭṭho kevalaṃ attano ajjhāsayeneva kathesi; seyyathidaṃ, ākaṅkheyyasuttaṃ, vatthasuttaṃ, mahāsatipaṭṭhānaṃ, mahāsaḷāyatanavibhaṅgasuttaṃ, ariyavaṃsasuttaṃ, sammappadhānasuttantahārako, iddhipādaindriyabalabojjhaṅgamaggaṅgasuttantahārakoti evamādīni; tesaṃ attajjhāsayo nikkhepo.
But those spoken on account of the inclination of others, having considered the maturity of the factors leading to liberation in Rāhula, thinking, “Now, the factors conducive to liberation in Rāhula are fully ripe; what if I were to lead Rāhula further to the destruction of the influxes?” (Saṃyutta Nikāya 4.121) having perceived their inclination, disposition, aspiration, and capacity for understanding, such as the Cūḷarāhulovāda Sutta, the Mahārāhulovāda Sutta, the Dhammacakkappavattana Sutta, the Dhātuvibhaṅga Sutta, and so forth, their setting forth is from the inclination of others.
Những bài kinh nào mà (Đức Thế Tôn) đã giảng, sau khi quán xét ý của người khác, sự nhẫn nại, tâm ý, và sự hướng tâm, và biết rằng "Các pháp đưa đến sự chín muồi giải thoát của Rāhula (La Hầu La) đã chín muồi; vậy ta hãy hướng dẫn Rāhula đến sự đoạn tận các lậu hoặc"; ví dụ như, kinh Cūḷarāhulovāda (kinh Giáo Giới La Hầu La), kinh Mahārāhulovāda (kinh Đại Giáo Giới La Hầu La), kinh Dhammacakkappavattana (kinh Chuyển Pháp Luân), kinh Dhātuvibhaṅga (kinh Phân Tích Giới), và những bài kinh tương tự; việc đưa ra những bài kinh đó là do ý của người khác.
Yāni pana ‘‘paripakkā kho rāhulassa vimuttiparipācaniyā dhammā; yaṃnūnāhaṃ rāhulaṃ uttariṃ āsavānaṃ khaye vineyya’’nti; (saṃ. ni. 4.121) evaṃ paresaṃ ajjhāsayaṃ khantiṃ manaṃ abhinīhāraṃ bujjhanabhāvañca avekkhitvā parajjhāsayavasena kathitāni; seyyathidaṃ, cūḷarāhulovādasuttaṃ, mahārāhulovādasuttaṃ, dhammacakkappavattanaṃ, dhātuvibhaṅgasuttanti evamādīni; tesaṃ parajjhāsayo nikkhepo.
But having approached the Blessed One, the four assemblies, the four castes, nāgas, supaṇṇas, gandhabbas, asuras, yakkhas, great kings, the Tāvatiṃsa gods, the great Brahmās, and so forth, asking questions with the method beginning, “The enlightenment factors, the enlightenment factors, venerable sir, are spoken of”. “The hindrances, the hindrances, venerable sir, are spoken of”. “Are these, venerable sir, the five aggregates of clinging”. “What, pray, is the supreme wealth for a person?”, those spoken by the Blessed One when asked thus, the Bojjhaṅga Saṃyutta, and so forth, or whatever other Devatā Saṃyutta, Māra Saṃyutta, Brahma Saṃyutta, Sakka Pañha, Cūḷavedalla, Mahāvedalla, Sāmaññaphala, Āḷavaka, Sūciloma, Kharaloma Suttas, and so forth, their setting forth is prompted by a question.
Còn nữa, bốn hội chúng, bốn giai cấp, Long vương, Kim sí điểu, Càn thát bà, A tu la, Dạ xoa, các vị Đại thiên vương, chư thiên cõi Tam Thập Tam, v.v., Đại Phạm Thiên, v.v., đến gặp Đức Thế Tôn và hỏi những câu hỏi như "Bạch ngài, các giác chi được gọi là giác chi". "Bạch ngài, các triền cái được gọi là triền cái"; "Bạch ngài, năm thủ uẩn này". "Cái gì là tài sản tối thượng của con người?" và những câu hỏi tương tự. Những bài kinh nào mà Đức Thế Tôn đã giảng sau khi được hỏi như vậy, như các kinh liên quan đến Bojjhaṅga (Giác Chi), v.v., hoặc bất kỳ bài kinh nào khác như Devatāsaṃyutta (Tương Ưng Chư Thiên), Mārasaṃyutta (Tương Ưng Ma), Brahmasaṃyutta (Tương Ưng Phạm Thiên), kinh Sakka-pañha (Đế Thích Vấn Kinh), kinh Cūḷavedalla (Tiểu Kinh Vedalla), kinh Mahāvedalla (Đại Kinh Vedalla), kinh Sāmaññaphala (kinh Sa Môn Quả), kinh Āḷavaka (kinh Dạ Xoa Āḷavaka), kinh Sūciloma (kinh Dạ Xoa Sūciloma), kinh Kharaloma (kinh Dạ Xoa Kharaloma), và những bài kinh tương tự; việc đưa ra những bài kinh đó là do câu hỏi.
Bhagavantaṃ pana upasaṅkamitvā catasso parisā, cattāro vaṇṇā, nāgā, supaṇṇā, gandhabbā, asurā, yakkhā, mahārājāno, tāvatiṃsādayo devā, mahābrahmāti evamādayo – ‘‘bojjhaṅgā bojjhaṅgā’’ti, bhante, vuccanti. ‘‘Nīvaraṇā nīvaraṇā’’ti, bhante, vuccanti; ‘‘ime nu kho, bhante, pañcupādānakkhandhā’’. ‘‘Kiṃ sūdha vittaṃ purisassa seṭṭha’’ntiādinā nayena pañhaṃ pucchanti. Evaṃ puṭṭhena bhagavatā yāni kathitāni bojjhaṅgasaṃyuttādīni, yāni vā panaññānipi devatāsaṃyutta-mārasaṃyutta-brahmasaṃyutta-sakkapañha-cūḷavedalla-mahāvedalla-sāmaññaphala-āḷavaka-sūciloma-kharalomasuttādīni; tesaṃ pucchāvasiko nikkhepo.
But those spoken on account of a situation that has arisen, such as the Dhammadāyāda, the Cūḷasīhanāda, the Candūpama, the Puttamaṃsūpama, the Dārukkhandhūpama, the Aggikkhandhūpama, the Pheṇapiṇḍūpama, the Pāricchattakūpama, and so forth, their setting forth is occasioned by a situation.
Những bài kinh nào mà đã được giảng do nhân duyên phát sinh, ví dụ như, kinh Dhammadāyāda (kinh Thừa Tự Pháp), kinh Cūḷasīhanāda (Tiểu Kinh Sư Tử Hống), kinh Candūpama (kinh Ví Dụ Mặt Trăng), kinh Puttamaṃsūpama (kinh Ví Dụ Thịt Con), kinh Dārukkhandhūpama (kinh Ví Dụ Khúc Gỗ), kinh Aggikkhandhūpama (kinh Ví Dụ Đống Lửa), kinh Pheṇapiṇḍūpama (kinh Ví Dụ Bọt Nước), kinh Pāricchattakūpama (kinh Ví Dụ Cây Pāricchattaka), và những bài kinh tương tự; việc đưa ra những bài kinh đó là do nhân duyên phát sinh.
Yāni pana tāni uppannaṃ kāraṇaṃ paṭicca kathitāni, seyyathidaṃ – dhammadāyādaṃ, cūḷasīhanādaṃ, candūpamaṃ, puttamaṃsūpamaṃ, dārukkhandhūpamaṃ, aggikkhandhūpamaṃ, pheṇapiṇḍūpamaṃ, pāricchattakūpamanti evamādīni; tesaṃ aṭṭhuppattiko nikkhepo.
Thus, among these four settings forth, the setting forth of this Sutta is occasioned by a situation. For this was set forth by the Blessed One on account of a situation. By what situation? By praise and dispraise. The teacher spoke dispraise of the Triple Gem, the pupil spoke praise. Thus, having made this situation of praise and dispraise, the Blessed One, skilled in teaching, began the teaching, “Others, monks, might speak dispraise of me.” Here, "of me" means a possessive case: the meaning is, of me. The word "or" has the sense of alternative. "Others" means opposing beings. "There" means, among those who speak dispraise.
Như vậy, trong bốn cách đưa ra bài kinh này, việc đưa ra bài kinh này là do nhân duyên phát sinh. Vì bài kinh này đã được Đức Thế Tôn đưa ra do nhân duyên phát sinh. Do nhân duyên phát sinh nào? Do sự khen chê (vaṇṇāvaṇṇe). Vị Đạo sư (Suppabuddha) đã nói lời chê bai Tam Bảo, còn người đệ tử (người hầu cận) đã nói lời khen ngợi. Như vậy, sau khi lấy sự khen chê này làm nhân duyên phát sinh, Đức Thế Tôn, bậc thiện xảo trong việc thuyết giảng, đã bắt đầu bài giảng với câu "Này các Tỳ kheo, nếu những người khác nói xấu ta...". Ở đó "mamanti" nghĩa là, lời nói của người sở hữu cách (sāmivacanaṃ), nghĩa là "của ta". Từ "vā" (hoặc) có nghĩa là sự lựa chọn. "Pare" (những người khác) nghĩa là, những chúng sanh đối nghịch. "Tatrā" (trong số đó) nghĩa là trong số những người nói lời chê bai.
Evametesu catūsu nikkhepesu imassa suttassa aṭṭhuppattiko nikkhepo. Aṭṭhuppattiyā hi idaṃ bhagavatā nikkhittaṃ. Katarāya aṭṭhuppattiyā? Vaṇṇāvaṇṇe. Ācariyo ratanattayassa avaṇṇaṃ abhāsi, antevāsī vaṇṇaṃ. Iti imaṃ vaṇṇāvaṇṇaṃ aṭṭhuppattiṃ katvā desanākusalo bhagavā – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’nti desanaṃ ārabhi. Tattha mamanti , sāmivacanaṃ, mamāti attho. Vāsaddo vikappanattho. Pareti, paṭiviruddhā sattā. Tatrāti ye avaṇṇaṃ vadanti tesu.
Although those monks do not have any ill-will with such things as "He does not have ill-will", the Blessed One established the law of Dhamma, preventing the arising of unwholesomeness in clansmen in the future even in such circumstances. Here, "ill-will" (āghāta) is that which strikes the mind; it is a term for anger. They are dissatisfied, displeased, and disagreeable because of that, hence "discontent" (appaccaya); it is a term for displeasure. He does not accomplish the welfare of either himself or others; this is “non-accomplishment” (anabhiraddhi); this is a synonym for anger. Thus, here the aggregate of mental formations is expressed by two terms, and the aggregate of feeling by one term; thus two aggregates are mentioned. By their means, the reason for the remaining associated mental phenomena is also rejected.
Với các câu như "không phẫn nộ", mặc dù chư Tỳ-kheo ấy không hề có phẫn nộ, nhưng Ngài [Đức Phật] thiết lập nguyên tắc Pháp (Pháp-nê-tí - dhammanettiṃ) ở đây, ngăn ngừa sự sanh khởi bất thiện trong những trường hợp tương tự đối với các thiện nam tử trong tương lai. Ở đây, "phẫn nộ" (āghāto) nghĩa là làm tổn thương tâm; đây là một từ đồng nghĩa của sân hận. "Bất mãn" (appaccayo) nghĩa là không hài lòng với điều đó, không hoan hỷ; đây là một từ đồng nghĩa của ưu não. "Không làm cho mình hay người khác được điều tốt đẹp" là "bất lợi" (anabhiraddhi); đây là một từ đồng nghĩa của sân hận. Như vậy, ở đây, hai uẩn đã được nói đến: Hành uẩn qua hai từ, và Thọ uẩn qua một từ. Dựa vào chúng, nhân của các pháp tương ưng còn lại cũng được xem là đã bị loại trừ.
Na āghātotiādīhi kiñcāpi tesaṃ bhikkhūnaṃ āghātoyeva natthi, atha kho āyatiṃ kulaputtānaṃ īdisesupi ṭhānesu akusaluppattiṃ paṭisedhento dhammanettiṃ ṭhapeti. Tattha āhanati cittanti ‘āghāto’; kopassetaṃ adhivacanaṃ. Appatītā honti tena atuṭṭhā asomanassikāti appaccayo; domanassassetaṃ adhivacanaṃ. Neva attano na paresaṃ hitaṃ abhirādhayatīti anabhiraddhi; kopassetaṃ adhivacanaṃ. Evamettha dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandhoti dve khandhā vuttā. Tesaṃ vasena sesānampi sampayuttadhammānaṃ kāraṇaṃ paṭikkhittameva.
Having thus eliminated mental দোষ (dosa) by the first method, and showing the disadvantage in it by the second method, he says: "If you were angry or displeased, that would be an obstacle for you." Here, "If you were" means, in regard to those who speak dispraise, or in that dispraise if you were to be; that is, if you were to become. "Angry" means by anger, and "displeased" means by displeasure. "That would be an obstacle for you" means that that anger and that displeasure would be an obstacle to your attaining the first jhana and so on.
Như vậy, sau khi ngăn chặn sự nhiễm ô của tâm bằng phương pháp thứ nhất, Ngài dạy về sự nguy hiểm của nó bằng phương pháp thứ hai, nói: "Ở đây, nếu các ông trở nên sân hận hay không hài lòng, thì chính điều đó sẽ là chướng ngại cho các ông." Ở đây, "Ở đây, nếu các ông trở nên" (tatra ce tumhe assathā) nghĩa là đối với những kẻ nói xấu đó, hoặc đối với lời nói xấu đó, nếu các ông trở nên; nghĩa là, nếu các ông có thể trở thành. "Sân hận" (kupitā) là do sân, "không hài lòng" (anattamanā) là do ưu não. "Thì chính điều đó sẽ là chướng ngại cho các ông" (tumhaṃ yevassa tena antarāyo) nghĩa là chính cơn sân đó, và chính sự không hài lòng đó của các ông, sẽ là chướng ngại cho Sơ Thiền, v.v.
Evaṃ paṭhamena nayena manopadosaṃ nivāretvā, dutiyena nayena tattha ādīnavaṃ dassento āha – ‘‘tatra ce tumhe assatha kupitā vā anattamanā vā, tumhaṃ yevassa tena antarāyo’’ti. Tattha ‘tatra ce tumhe assathā’ti tesu avaṇṇabhāsakesu, tasmiṃ vā avaṇṇe tumhe bhaveyyātha ce; yadi bhaveyyāthāti attho. ‘Kupitā’ kopena, anattamanā domanassena. ‘Tumhaṃ yevassa tena antarāyo’ti tumhākaṃyeva tena kopena, tāya ca anattamanatāya paṭhamajjhānādīnaṃ antarāyo bhaveyya.
Having thus shown the disadvantage by the second method, and showing by the third method the inability even in mere characteristics of words, he says: "But do you... of others" and so on. Here "of others" means of anyone at all. An angry person does not understand the meaning of what is well-spoken or ill-spoken by Buddhas, Paccekabuddhas, or Noble Disciples, nor by mother and father, nor by adversaries. As he said:
Như vậy, sau khi chỉ ra sự nguy hiểm bằng phương pháp thứ hai, để chỉ ra sự bất lực ngay cả trong việc nhận biết nghĩa của lời nói bằng phương pháp thứ ba, Ngài nói: "Liệu các ông đối với những người khác". Ở đây, "những người khác" (paresanti) nghĩa là bất kỳ ai. Bởi vì người sân hận không nhận biết được ý nghĩa của lời nói tốt hay lời nói xấu, không phải của Đức Phật, Chư Phật Độc Giác, hay các bậc Thánh Thinh Văn, không phải của cha mẹ, không phải của kẻ thù. Như đã nói:
Evaṃ dutiyena nayena ādīnavaṃ dassetvā, tatiyena nayena vacanatthasallakkhaṇamattepi asamatthataṃ dassento – ‘‘api nu tumhe paresa’’ntiādimāha. Tattha paresanti yesaṃ kesaṃ ci. Kupito hi neva buddhapaccekabuddhaariyasāvakānaṃ, na mātāpitūnaṃ, na paccatthikānaṃ subhāsitadubbhāsitassa atthaṃ ājānāti. Yathāha –
"An angry person does not know the meaning, an angry person does not see the Dhamma;
"Kẻ sân không biết lợi ích, kẻ sân không thấy Chánh Pháp;
‘‘Kuddho atthaṃ na jānāti, kuddho dhammaṃ na passati;
Blind darkness occurs then, when anger overwhelms a person.
Khi ấy là bóng tối dày đặc, khi sân hận chế ngự con người.
Andhaṃ tamaṃ tadā hoti, yaṃ kodho sahate naraṃ.
Anger generates harm, anger agitates the mind;
Sân hận sinh ra bất lợi, sân hận khuấy động tâm;
Anatthajanano kodho, kodho cittappakopano;
The danger that arises from within, that person does not understand." (a. ni. 7.64);
Sợ hãi sinh ra từ bên trong, mà người ấy không nhận biết." (A-ni. 7.64);
Bhayamantarato jātaṃ, taṃ jano nāvabujjhatī’’ti. (a. ni. 7.64);
Having thus refuted mental displeasure regarding dispraise in every way, he now shows the way to practice, saying: "There you should determine the untrue as untrue," and so on.
Như vậy, sau khi ngăn chặn hoàn toàn sự nhiễm ô của tâm đối với những lời nói xấu, bây giờ, để chỉ ra cách thức thực hành, Ngài nói: "Ở đây, các ông nên hiểu rõ điều không thật là không thật".
Evaṃ sabbathāpi avaṇṇe manopadosaṃ nisedhetvā idāni paṭipajjitabbākāraṃ dassento – ‘‘tatra tumhehi abhūtaṃ abhūtato’’tiādimāha.
Here, “There you” means, in that dispraise, you. "What is untrue should be removed as untrue" means that what is untrue should be removed as untrue. How? By the method such as “it is untrue”, and so on. Here is the connection: “Your teacher is not omniscient, the Dhamma is poorly proclaimed, the Sangha is poorly practiced," and so on, one should not remain silent upon hearing. Instead, one should say: "This is untrue, what you have said is untrue for this reason, it is also not factual for this reason, 'this is not present in us,' 'and this is not found in us,' our teacher is indeed omniscient, the Dhamma is well-proclaimed, the Sangha is well-practiced, and here are these and these reasons." Here, the second term should be understood as synonymous with the first, and the fourth with the third. And this refutation should be done only in the case of dispraise, not everywhere. If, when one is told, "You are immoral, your teacher is immoral, and you have done this and that, your teacher has done this and that," one silently tolerates it, one becomes suspect. Therefore, without creating mental displeasure, dispraise should be refuted. However, one should ignore and bear with patience a person who insults with the ten grounds of abuse, such as, "You are a lip, you are a bull," and so on.
Ở đây, "Ở đây, các ông" (tatra tumhehī) nghĩa là, đối với lời nói xấu đó, các ông. "Điều không thật nên được loại bỏ như là không thật" (abhūtaṃ abhūtato nibbeṭhetabbanti) nghĩa là điều gì không thật, thì nên loại bỏ nó theo cách nó không thật. Bằng cách nào? Bằng cách như: "Điều này là không thật". Ở đây, sự kết nối là như sau: Sau khi nghe những điều như: "Đạo sư của các ông không phải là bậc Toàn Giác, Pháp không được khéo thuyết, Tăng không khéo thực hành", thì không nên im lặng. Mà nên nói như thế này: "Điều này là không thật, điều mà các ông nói, điều đó không thật theo lý do này, không thật theo lý do kia, 'điều này không có ở trong chúng tôi', 'và điều này không tồn tại trong chúng tôi', Đạo sư của chúng tôi là bậc Toàn Giác, Pháp được khéo thuyết, Tăng khéo thực hành, ở đây đây là lý do." Và ở đây, cần phải hiểu rằng từ thứ hai là từ đồng nghĩa của từ thứ nhất, và từ thứ tư là từ đồng nghĩa của từ thứ ba. Và việc làm rõ này chỉ nên được thực hiện đối với những lời nói xấu, không phải trong mọi trường hợp. Bởi vì nếu khi bị nói: "Ngươi là kẻ phạm giới, đạo sư của ngươi là kẻ phạm giới, ngươi đã làm điều này điều kia, đạo sư của ngươi đã làm", mà im lặng chấp nhận, thì sẽ bị nghi ngờ. Vì vậy, không nên tạo ra sự nhiễm ô của tâm, mà nên làm rõ lời nói xấu. Nhưng đối với người lăng mạ bằng mười đối tượng lăng mạ như: "Ngươi là con lừa, ngươi là con bò", v.v., thì nên xả bỏ, thực hành nhẫn nhục chịu đựng.
Tattha tatra tumhehīti, tasmiṃ avaṇṇe tumhehi. Abhūtaṃ abhūtato nibbeṭhetabbanti yaṃ abhūtaṃ, taṃ abhūtabhāveneva apanetabbaṃ. Kathaṃ? Itipetaṃ abhūtantiādinā nayena. Tatrāyaṃ yojanā – ‘‘tumhākaṃ satthā na sabbaññū, dhammo durakkhāto, saṅgho duppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ. Evaṃ pana vattabbaṃ – ‘‘iti petaṃ abhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena abhūtaṃ, imināpi kāraṇena atacchaṃ, ‘natthi cetaṃ amhesu’, ‘na ca panetaṃ amhesu saṃvijjati’, sabbaññūyeva amhākaṃ satthā, svākkhāto dhammo, suppaṭipanno saṅgho, tatra idañcidañca kāraṇa’’nti. Ettha ca dutiyaṃ padaṃ paṭhamassa, catutthañca tatiyassa vevacananti veditabbaṃ. Idañca avaṇṇeyeva nibbeṭhanaṃ kātabbaṃ, na sabbattha. Yadi hi ‘‘tvaṃ dussīlo, tavācariyo dussīlo, idañcidañca tayā kataṃ, tavācariyena kata’’nti vutte tuṇhībhūto adhivāseti, āsaṅkanīyo hoti. Tasmā manopadosaṃ akatvā avaṇṇo nibbeṭhetabbo. ‘‘Oṭṭhosi, goṇosī’’tiādinā pana nayena dasahi akkosavatthūhi akkosantaṃ puggalaṃ ajjhupekkhitvā adhivāsanakhantiyeva tattha kātabbā.
6. Having thus shown the characteristic of being unwavering in the face of dispraise, now, to show it in the face of praise, he says: "Or if others, monks, should speak praise of me," and so on. Here, "others" means any devoted gods and humans. "Joy" (ānanda) is that by which one rejoices; it is a term for gladness. The state of being pleased is "contentment" (somanassa); it is a term for mental happiness. The state of being elated is “elatedness” (uppilāvitatta). Whose elatedness? Of the mind. It is a synonym for the uplifting joy that leads to excitement. Here too, the aggregate of mental formations is expressed by two terms, and the aggregate of feeling by one term.
6. Như vậy, sau khi chỉ ra đặc tính của sự nhẫn nhục trong trường hợp bị nói xấu, bây giờ, để chỉ ra điều đó trong trường hợp được khen ngợi, Ngài nói: "Hoặc, này các Tỳ-kheo, nếu người khác khen ngợi ta". Ở đây, "người khác" (pareti) nghĩa là bất kỳ chư thiên và loài người nào có lòng tin. "Điều gì làm cho hoan hỷ" (ānandanti etenāti) là "sự hoan hỷ" (ānando), đây là một từ đồng nghĩa của hỷ (pīti). Trạng thái của người hoan hỷ (sumanassa) là "sự hoan hỷ" (somanassaṃ), đây là một từ đồng nghĩa của lạc thọ về tâm (cetasikasukha). Trạng thái của người phấn chấn (uppilāvino) là "sự phấn chấn" (uppilāvitattaṃ). Sự phấn chấn của ai? Của tâm (cetaso). Đây là một từ đồng nghĩa của sự hỷ phấn chấn đưa đến trạo cử (uddhaccāvahāya uppilāpanapītiyā). Ở đây cũng vậy, hai uẩn đã được nói đến qua hai từ: Hành uẩn, và Thọ uẩn qua một từ.
6. Evaṃ avaṇṇabhūmiyaṃ tādilakkhaṇaṃ dassetvā idāni vaṇṇabhūmiyaṃ dassetuṃ ‘‘mamaṃ vā, bhikkhave, pare vaṇṇaṃ bhāseyyu’’ntiādimāha. Tattha pareti ye keci pasannā devamanussā. Ānandanti etenāti ānando, pītiyā etaṃ adhivacanaṃ. Sumanassa bhāvo somanassaṃ, cetasikasukhassetaṃ adhivacanaṃ. Uppilāvino bhāvo uppilāvitattaṃ. Kassa uppilāvitattanti? Cetasoti. Uddhaccāvahāya uppilāpanapītiyā etaṃ adhivacanaṃ. Idhāpi dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandho vutto.
Having thus eliminated elatedness by the first method, showing the disadvantage in it by the second method, he says: "If you were there," and so on. Here too, "That would be an obstacle for you" means that that elatedness would be an obstacle to your attaining the first jhāna and so on. This should be understood. But why is this said? Has the Blessed One not said:
Như vậy, sau khi ngăn chặn sự phấn chấn bằng phương pháp thứ nhất, để chỉ ra sự nguy hiểm của nó bằng phương pháp thứ hai, Ngài nói: "Ở đây, nếu các ông trở nên". Ở đây, "Thì chính điều đó sẽ là chướng ngại cho các ông" (tumhaṃ yevassa tena antarāyo) nghĩa là chính sự phấn chấn đó của các ông sẽ là chướng ngại cho Sơ Thiền, v.v., cần phải hiểu như vậy. Nhưng tại sao điều này lại được nói? Chẳng phải Đức Thế Tôn đã nói:
Evaṃ paṭhamanayena uppilāvitattaṃ nivāretvā, dutiyena tattha ādīnavaṃ dassento – ‘‘tatra ce tumhe assathā’’tiādimāha. Idhāpi tumhaṃ yevassa tena antarāyoti tena uppilāvitattena tumhākaṃyeva paṭhamajjhānādīnaṃ antarāyo bhaveyyāti attho veditabbo. Kasmā panetaṃ vuttaṃ? Nanu bhagavatā –
"When one proclaims, 'Buddha,' the joy that arises in the body;
"Đối với người tán dương 'Phật', hỷ sanh khởi trong thân;
‘‘Buddhoti kittayantassa, kāye bhavati yā pīti;
That joy is better, even with the entirety of Jambudīpa.
Hỷ ấy còn tốt đẹp hơn, cả vương quốc Diêm-phù-đề.
Varameva hi sā pīti, kasiṇenāpi jambudīpassa.
When one proclaims, 'Dhamma,' the joy that arises in the body;
Đối với người tán dương 'Pháp', hỷ sanh khởi trong thân;
Dhammoti kittayantassa, kāye bhavati yā pīti;
That joy is better, even with the entirety of Jambudīpa.
Hỷ ấy còn tốt đẹp hơn, cả vương quốc Diêm-phù-đề.
Varameva hi sā pīti, kasiṇenāpi jambudīpassa.
When one proclaims, 'Sangha,' the joy that arises in the body;
Đối với người tán dương 'Tăng', hỷ sanh khởi trong thân;
Saṅghoti kittayantassa, kāye bhavati yā pīti;
That joy is better, even with the entirety of Jambudīpa."
Hỷ ấy còn tốt đẹp hơn, cả vương quốc Diêm-phù-đề."
Varameva hi sā pīti, kasiṇenāpi jambudīpassā’’ti ca.
“Monks, those who are confident in the Buddha, they are confident in the foremost" and so on, in many hundreds of suttas, is joy and gladness in the Triple Gem not praised? It is true that it is praised, but that is based on renunciation. Here, in the manner of "Our Buddha, our Dhamma," and so on, the joy and gladness based on household life, similar to that which arose in the Venerable Channa, is intended. This is indeed an obstacle to attaining the jhānas and so on. Therefore, the Venerable Channa, as long as the Buddha had not passed away, was unable to achieve any distinction, but at the time of the passing away, rebuked by the Brahma-punishment declared, he abandoned that joy and gladness and achieved distinction. Therefore, it should be understood that this is said referring to it as an obstacle. For this is joy associated with greed. And greed is similar to anger. As he said:
Và: "Này các Tỳ-kheo, những ai có lòng tin vào Đức Phật, là có lòng tin vào điều tối thượng", và như vậy, trong hàng trăm bài kinh, Ngài đã tán dương sự hỷ lạc đối với Tam Bảo hay sao? Đúng là Ngài đã tán dương, nhưng đó là sự hỷ lạc nương vào sự xuất ly (nekkhammanissitaṃ). Ở đây, Ngài muốn nói đến sự hỷ lạc nương vào sự ràng buộc (gehassitaṃ), giống như sự hỷ lạc đã sanh khởi nơi Tôn giả Channa (Channa) khi nghĩ: "Phật của chúng ta, Pháp của chúng ta", v.v. Bởi vì điều này là chướng ngại cho sự chứng đắc Thiền, v.v. Chính vì vậy, Tôn giả Channa, cho đến khi Đức Phật chưa nhập Niết-bàn, đã không thể chứng đắc được sự thù thắng, nhưng vào lúc Đức Phật nhập Niết-bàn, Ngài đã chế định hình phạt Phạm-đàn-trà (brahmadaṇḍa) đối với Tôn giả, và Tôn giả đã từ bỏ sự hỷ lạc đó và chứng đắc được sự thù thắng. Vì vậy, cần phải hiểu rằng điều này được nói đến là để chỉ ra sự chướng ngại. Bởi vì đây là sự hỷ đi kèm với tham. Và tham cũng giống như sân. Như đã nói:
‘‘Ye, bhikkhave, buddhe pasannā, agge te pasannā’’ti ca evamādīhi anekasatehi suttehi ratanattaye pītisomanassameva vaṇṇitanti. Saccaṃ vaṇṇitaṃ, taṃ pana nekkhammanissitaṃ. Idha – ‘‘amhākaṃ buddho, amhākaṃ dhammo’’tiādinā nayena āyasmato channassa uppannasadisaṃ gehassitaṃ pītisomanassaṃ adhippetaṃ. Idañhi jhānādipaṭilābhāya antarāyakaraṃ hoti. Tenevāyasmā channopi yāva buddho na parinibbāyi, tāva visesaṃ nibbattetuṃ nāsakkhi, parinibbānakāle paññattena pana brahmadaṇḍena tajjito taṃ pītisomanassaṃ pahāya visesaṃ nibbattesi. Tasmā antarāyakaraṃyeva sandhāya idaṃ vuttanti veditabbaṃ. Ayañhi lobhasahagatā pīti. Lobho ca kodhasadisova. Yathāha –
"A greedy person does not know the meaning, a greedy person does not see the Dhamma;
"Kẻ tham không biết lợi ích, kẻ tham không thấy Chánh Pháp;
‘‘Luddho atthaṃ na jānāti, luddho dhammaṃ na passati;
Blind darkness occurs then, when greed overwhelms a person.
Khi ấy là bóng tối dày đặc, khi tham lam chế ngự con người.
Andhaṃ tamaṃ tadā hoti, yaṃ lobho sahate naraṃ.
Greed generates harm, greed agitates the mind;
Tham lam sinh ra bất lợi, tham lam khuấy động tâm;
Anatthajanano lobho, lobho cittappakopano;
The danger that arises from within, that person does not understand." (itivu. 88);
Sợ hãi sinh ra từ bên trong, mà người ấy không nhận biết." (Itivu. 88);
Bhayamantarato jātaṃ, taṃ jano nāvabujjhatī’’ti. (itivu. 88);
The third instance, however, although not forthcoming here, should be understood as already present in meaning. Just as an angry person, so too a greedy person does not know the meaning.
Còn lượt thứ ba thì, ở đây, mặc dù không được đề cập trực tiếp, nhưng về ý nghĩa thì đã bao hàm. Bởi vì, cũng giống như người sân hận, người tham lam cũng không biết được lợi ích.
Tatiyavāro pana idha anāgatopi atthato āgato yevāti veditabbo. Yatheva hi kuddho, evaṃ luddhopi atthaṃ na jānātīti.
In the passage showing the manner of practice, this is the connection: "Hearing such things as 'Your teacher is omniscient, an Arahant, a Perfectly Self-Enlightened One, the Dhamma is well-proclaimed, the Sangha is well-practiced,' and so on, one should not remain silent. Instead, one should acknowledge it thus: "This is true, what you have said is true for this reason, it is also factual for this reason. For the Blessed One is indeed an Arahant for this reason, a Perfectly Self-Enlightened One for this reason; the Dhamma is indeed well-proclaimed for this reason, directly visible for this reason; the Sangha is indeed well-practiced for this reason, uprightly practiced for this reason." Even when asked, "Are you virtuous?" if one is virtuous, one should acknowledge, "I am virtuous." Even when asked, "Are you an attainer of the first jhāna... and so on... an Arahant?" one should acknowledge it only to suitable monks. For in this way, both evil wishes are avoided, and the unfailing nature of the teaching is illuminated. The rest should be understood in the manner already stated.
Trong phần chỉ ra cách thức thực hành, sự kết nối là như sau: Sau khi nghe những điều như: "Đạo sư của các ông là bậc Toàn Giác, bậc A-la-hán, bậc Chánh Đẳng Giác, Pháp được khéo thuyết, Tăng khéo thực hành", thì không nên im lặng. Mà nên thừa nhận như thế này: "Điều này là thật, điều mà các ông nói, điều đó là thật theo lý do này, là chân thật theo lý do kia. Vì Đức Thế Tôn ấy là bậc A-la-hán theo nghĩa này, là bậc Chánh Đẳng Giác theo nghĩa này; Pháp là khéo thuyết theo nghĩa này, là thiết thực hiện tại theo nghĩa này; Tăng là khéo thực hành theo nghĩa này, là chân chánh thực hành theo nghĩa này." Nếu được hỏi: "Ngươi có giới hạnh không?", nếu có giới hạnh, thì nên thừa nhận: "Tôi có giới hạnh." Nếu được hỏi: "Ngươi có chứng đắc Sơ Thiền... cho đến... bậc A-la-hán không?", thì chỉ nên thừa nhận với những vị Tỳ-kheo đồng phạm hạnh. Bởi vì như vậy, vừa tránh được ác dục, vừa làm cho giáo pháp không trở nên vô ích. Phần còn lại cần phải hiểu theo cách đã được nói.
Paṭipajjitabbākāradassanavāre panāyaṃ yojanā – ‘‘tumhākaṃ satthā sabbaññū arahaṃ sammāsambuddho, dhammo svākkhāto, saṅgho suppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ. Evaṃ pana paṭijānitabbaṃ – ‘‘itipetaṃ bhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena bhūtaṃ, imināpi kāraṇena tacchaṃ. So hi bhagavā itipi arahaṃ, itipi sammāsambuddho; dhammo itipi svākkhāto, itipi sandiṭṭhiko ; saṅgho itipi suppaṭipanno, itipi ujuppaṭipanno’’ti. ‘‘Tvaṃ sīlavā’’ti pucchitenāpi sace sīlavā, ‘‘sīlavāhamasmī’’ti paṭijānitabbameva. ‘‘Tvaṃ paṭhamassa jhānassa lābhī…pe… arahā’’ti puṭṭhenāpi sabhāgānaṃ bhikkhūnaṃyeva paṭijānitabbaṃ. Evañhi pāpicchatā ceva parivajjitā hoti, sāsanassa ca amoghatā dīpitā hotīti. Sesaṃ vuttanayeneva veditabbaṃ.
The Explanation of the Lesser Morality
Phần Giải Thích về Tiểu Giới
Cūḷasīlavaṇṇanā
7. "But this, monks, is trivial," what is the connection? This sutta is composed of two parts: dispraise and praise. Here, the dispraise – "This is untrue, this is not factual" – having reached its limit, like fire, is extinguished. But the praise continues thus: "It should be acknowledged what is true as true" – "This is true." This praise is of two kinds: the praise spoken by Brahmadatta and the praise initiated by the Sangha of monks, saying "Wonderful, friend," and so on. Regarding the praise spoken by the Sangha of monks, he will show the connection in the exposition of emptiness above. But here, to show the connection of the praise spoken by Brahmadatta, the teaching is begun with "But this, monks, is trivial."
7."Này các Tỳ-kheo, đây chỉ là một phần nhỏ" (Appamattakaṃ kho panetaṃ, bhikkhaveti), sự liên kết là gì? Bài kinh này được kết nối bởi hai phần: khen ngợi và chê bai. Trong đó, phần chê bai: "Điều này là không thật, điều này là không chân thật", đã dừng lại ở đó, giống như lửa gặp nước. Còn phần khen ngợi: "Điều thật nên được thừa nhận là thật" - "Điều này là thật", thì vẫn tiếp tục. Phần khen ngợi đó có hai loại: phần khen ngợi do Brahmādatta (Phạm-Thiên-Thọ) nói, và phần khen ngợi do Tăng chúng Tỳ-kheo khởi xướng với cách nói "Thật kỳ diệu, này các Hiền giả", v.v. Trong số đó, Ngài sẽ chỉ ra sự liên kết trong việc làm sáng tỏ tính Không ở phần trên của phần khen ngợi do Tăng chúng Tỳ-kheo nói. Ở đây, để chỉ ra sự liên kết của phần khen ngợi do Brahmādatta nói, bài pháp "Này các Tỳ-kheo, đây chỉ là một phần nhỏ" đã được bắt đầu.
7.Appamattakaṃ kho panetaṃ, bhikkhaveti ko anusandhi? Idaṃ suttaṃ dvīhi padehi ābaddhaṃ vaṇṇena ca avaṇṇena ca. Tattha avaṇṇo – ‘‘iti petaṃ abhūtaṃ iti petaṃ ataccha’’nti, ettheva udakantaṃ patvā aggiviya nivatto. Vaṇṇo pana bhūtaṃ bhūtato paṭijānitabbaṃ – ‘‘iti petaṃ bhūta’’nti evaṃ anuvattatiyeva. So pana duvidho brahmadattena bhāsitavaṇṇo ca bhikkhusaṅghena acchariyaṃ āvusotiādinā nayena āraddhavaṇṇo ca. Tesu bhikkhusaṅghena vuttavaṇṇassa upari suññatāpakāsane anusandhiṃ dassessati. Idha pana brahmadattena vuttavaṇṇassa anusandhiṃ dassetuṃ ‘‘appamattakaṃ kho panetaṃ, bhikkhave’’ti desanā āraddhā.
Herein, "small" is a name for minor. "Inferior" is another term for the same. "Measure" is called an extent. Something with a small measure is "small." Something with a lesser measure is "inferior." Morality alone is merely morality. This is said: 'This, monks, is a small, inferior, thing, mere morality,' something that even a worldling might praise after making an effort, saying "I speak in praise of the Thus-Gone One". Herein, it might be: Is not this morality the foremost ornament of the recluse? As the ancients said:
Ở đây, *appamattaka* là tên gọi của sự nhỏ bé. *Oramattaka* là một từ đồng nghĩa của nó. *Mattā* được gọi là ಪ್ರಮಾಣ (lượng, mức độ). *Appaṃ mattā etassāti appamattakaṃ* (ít ỏi về lượng nên gọi là nhỏ bé). *Oraṃ mattā etassāti oramattakaṃ* (thấp kém về lượng nên gọi là hạ liệt). *Sīlamattakaṃ* chính là giới. Điều này được nói như sau – Này các Tỳ kheo, phàm phu tán dương Như Lai bằng giới, dù có nỗ lực tán dương đến đâu, thì cái được gọi là giới ấy cũng chỉ là "nhỏ bé, hạ liệt, chỉ có giới mà thôi". Ở đây có thể có người hỏi – Chẳng phải giới này là sự trang nghiêm bậc nhất của hành giả hay sao? Như các bậc cổ đức đã nói:
Tattha appamattakanti parittassa nāmaṃ. Oramattakanti tasseva vevacanaṃ. Mattāti vuccati pamāṇaṃ. Appaṃ mattā etassāti appamattakaṃ. Oraṃ mattā etassāti oramattakaṃ. Sīlameva sīlamattakaṃ. Idaṃ vuttaṃ hoti – ‘appamattakaṃ kho, panetaṃ bhikkhave, oramattakaṃ sīlamattakaṃ’ nāma yena ‘‘tathāgatassa vaṇṇaṃ vadāmī’’ti ussāhaṃ katvāpi vaṇṇaṃ vadamāno puthujjano vadeyyāti. Tattha siyā – nanu idaṃ sīlaṃ nāma yogino aggavibhūsanaṃ? Yathāhu porāṇā –
"Morality is the recluse's adornment, morality is the recluse's decoration;
"Giới là trang sức của hành giả, giới là sự trang nghiêm của hành giả;
‘‘Sīlaṃ yogissa’laṅkāro, sīlaṃ yogissa maṇḍanaṃ;
The recluse adorned with morality attains the highest in decoration."
Hành giả trang sức bằng giới, đạt đến sự trang nghiêm bậc nhất."
Sīlehi’laṅkato yogī, maṇḍane aggataṃ gato’’ti.
And by the Blessed One, in hundreds of discourses, morality has been taught as something great. As he said: "If, monks, a monk should wish: 'May I be dear and pleasing to my fellow monks, respected and worthy of esteem', let him be a fulfiller in the moralities." (MN. I.65)
Và Đức Thế Tôn, trong vô số bài kinh, đã nói về giới như là một điều vĩ đại. Như Ngài đã dạy: "Nếu, này các Tỳ kheo, vị Tỳ kheo mong muốn 'Ta được các vị đồng phạm hạnh yêu mến, khả ái, cung kính và tôn trọng', thì vị ấy phải thành tựu viên mãn giới"
Bhagavatāpi ca anekesu suttasatesu sīlaṃ mahantameva katvā kathitaṃ. Yathāha – ‘‘ākaṅkheyya ce, bhikkhave, bhikkhu ‘sabrahmacārīnaṃ piyo cassaṃ manāpo ca garu ca bhāvanīyo cā’ti, sīlesvevassa paripūrakārī’’ti (ma. ni. 1.65) ca.
"As a curlew her egg, as a yak her tail;
"Như chim Kiki (Trĩ) bảo vệ trứng, như bò yak bảo vệ lông đuôi;
‘‘Kikīva aṇḍaṃ, camarīva vāladhiṃ;
As a father his dear son, as a man his only eye.
Như người mẹ bảo vệ đứa con yêu, như người một mắt bảo vệ con mắt.
Piyaṃva puttaṃ, nayanaṃva ekakaṃ.
Even so, guarding morality;
Cũng vậy, hãy bảo vệ giới;
Tatheva sīlaṃ, anurakkhamānā;
Be excellent, always respectful."
Hãy là người thiện giới, luôn cung kính (giới)."
Supesalā hotha, sadā sagāravā’’ti ca.
"The scent of flowers does not go against the wind;
"Hương hoa không bay ngược gió;
‘‘Na pupphagandho paṭivātameti;
Nor does that of sandalwood, eaglewood or jasmine.
Không hương chiên đàn, hương ta-già-la, hương mạt-lợi.
Na candanaṃ taggaramallikā vā.
But the scent of the virtuous goes against the wind;
Hương của người đức hạnh bay ngược gió;
Satañca gandho paṭivātameti;
A good person pervades all directions.
Người thiện sĩ tỏa hương khắp mọi phương.
Sabbā disā sappuriso pavāyati.
Sandalwood or eaglewood, the lotus or the jasmine;
Chiên đàn hay ta-già-la, hoa sen hay vũ quý;
Candanaṃ tagaraṃ vāpi, uppalaṃ atha vassikī;
Among these kinds of fragrances, the fragrance of virtue is unsurpassed.
Trong các loại hương này, hương giới là vô thượng.
Etesaṃ gandhajātānaṃ, sīlagandho anuttaro.
Small is this fragrance, that of eaglewood and sandalwood;
Ít ỏi thay hương thơm này, là hương chiên đàn ta-già-la;
Appamatto ayaṃ gandho, yvāyaṃ tagaracandanaṃ;
But the fragrance of the virtuous blows supreme among the gods.
Còn hương của người trì giới, bay đến chư Thiên, tối thượng.
Yo ca sīlavataṃ gandho, vāti devesu uttamo.
Of those accomplished in virtue, dwelling in diligence;
Với những ai đầy đủ giới hạnh, sống không phóng dật;
Tesaṃ sampannasīlānaṃ, appamādavihārinaṃ;
Liberated by perfect knowledge, Mara does not find their path." (Dhp. 57)
Giải thoát nhờ chánh trí, Ma Vương không tìm thấy đường đi."
Sammadaññā vimuttānaṃ, māro maggaṃ na vindatī’’ti ca. (dha. pa. 57);
"A wise person established in morality, developing mind and wisdom;
"Người có trí tuệ, an trú vào giới, tu tập tâm và tuệ;
‘‘Sīle patiṭṭhāya naro sapañño, cittaṃ paññañca bhāvayaṃ;
An ardent, prudent monk, he untangles this tangle." (SN. I.23)
Nhiệt tâm, tinh cần, vị Tỳ kheo ấy gỡ rối được mớ bòng bong này."
Ātāpī nipako bhikkhu, so imaṃ vijaṭaye jaṭa’’nti ca. (saṃ. ni. 1.23);
"Just as, monks, whatever seeds and plants grow, increase and flourish, all of them, relying on the earth, established on the earth; thus these seeds and plants grow, increase and flourish. Just so, monks, a monk relying on morality, established on morality, developing the seven factors of enlightenment, cultivating the seven factors of enlightenment, attains growth, increase, and flourishing in the teachings." (SN. V.150) Many other such discourses should be considered. Thus, in hundreds of discourses, morality has been taught as something great. Why then is it here called "small"? It is said with reference to the superior qualities. For morality does not attain concentration, and concentration does not attain wisdom; therefore, with reference to the higher, the lower is called inferior. How does morality not attain concentration? When the Blessed One, in the seventh year after his full enlightenment, was sitting at the gate of Savatthi, at the foot of the Kandamba tree, in a pavilion of jewels twelve yojanas across, on a jeweled throne one yojana in extent, under a divine white umbrella three yojanas wide, a demonstration of twin miracle was given to a gathering of twelve yojanas, that illuminated himself and those around him, quelling heretics — "From the upper part of the body a mass of flames arises, from the lower part of the body a stream of water arises...from each single hair follicle a mass of flames arises, from each single hair follicle a stream of water arises, of six colours" and so forth. From his golden-hued body, golden rays emanated reaching to the Brahma-world, like an adornment of the entire ten-thousand-world system, second and second rays like the first and the first pairs arising as if at a single moment.
"Ví như, này các Tỳ kheo, bất cứ loại hạt giống, cây cối nào tăng trưởng, phát triển, lớn mạnh, tất cả chúng đều nương nhờ đất, an trú trên đất; những loại hạt giống, cây cối này tăng trưởng, phát triển, lớn mạnh. Cũng vậy, này các Tỳ kheo, vị Tỳ kheo nương nhờ giới, an trú vào giới, tu tập bảy giác chi, làm cho sung mãn bảy giác chi, thì đạt được sự tăng trưởng, phát triển, lớn mạnh trong các pháp." Cần phải xem xét nhiều bài kinh khác như vậy. Như vậy, trong vô số bài kinh, giới được nói đến như là một điều vĩ đại. Vậy tại sao ở chỗ này lại nói giới là "nhỏ bé"? Vì so sánh với các công đức ở phía trên. Giới không đạt đến định, định không đạt đến tuệ, vì vậy, so với cái trên thì cái dưới được gọi là hạ liệt. Làm thế nào giới không đạt đến định? Đức Thế Tôn, sau khi chứng ngộ Vô Thượng Chánh Đẳng Giác, vào năm thứ bảy, tại cửa thành Sāvatthi (Xá Vệ), dưới gốc cây Kaṇḍamba, trong bảo điện bằng châu báu rộng mười hai do-tuần, ngồi trên bảo tọa bằng châu báu rộng một do-tuần, dưới lọng trắng chư thiên rộng ba do-tuần, trước hội chúng rộng mười hai do-tuần, Ngài đã thể hiện thần thông song hành (yamakapāṭihāriya) để hiển thị sự tự mình chứng ngộ, hàng phục ngoại đạo – "từ phần thân trên phát ra ngọn lửa, từ phần thân dưới phát ra dòng nước… từ mỗi lỗ chân lông phát ra ngọn lửa, từ mỗi lỗ chân lông phát ra dòng nước, với sáu màu sắc", theo cách như vậy. Từ thân sắc vàng của Ngài, các tia sáng màu vàng phóng ra cho đến đỉnh của hữu biên, giống như thời điểm trang hoàng của toàn thể mười ngàn thế giới, các tia sáng thứ hai, thứ hai nữa giống như các cặp song hành trước, trước nữa, dường như khởi lên trong cùng một sát-na.
‘‘Seyyathāpi, bhikkhave, ye keci bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti, sabbe te pathaviṃ nissāya, pathaviyaṃ patiṭṭhāya; evamete bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti. Evameva kho, bhikkhave, bhikkhu sīlaṃ nissāya sīle patiṭṭhāya sattabojjhaṅge bhāvento sattabojjhaṅge bahulīkaronto vuḍḍhiṃ virūḷhiṃ vepullaṃ pāpuṇāti dhammesū’’ti (saṃ. ni. 5.150) ca. Evaṃ aññānipi anekāni suttāni daṭṭhabbāni. Evamanekesu suttasatesu sīlaṃ mahantameva katvā kathitaṃ. Taṃ ‘‘kasmā imasmiṃ ṭhāne appamattaka’’nti āhāti? Upari guṇe upanidhāya. Sīlañhi samādhiṃ na pāpuṇāti, samādhi paññaṃ na pāpuṇāti, tasmā uparimaṃ upanidhāya heṭṭhimaṃ oramattakaṃ nāma hoti. Kathaṃ sīlaṃ samādhiṃ na pāpuṇāti? Bhagavā hi abhisambodhito sattame saṃvacchare sāvatthinagara – dvāre kaṇḍambarukkhamūle dvādasayojane ratanamaṇḍape yojanappamāṇe ratanapallaṅke nisīditvā tiyojanike dibbasetacchatte dhāriyamāne dvādasayojanāya parisāya attādānaparidīpanaṃ titthiyamaddanaṃ – ‘‘uparimakāyato aggikkhandho pavattati, heṭṭhimakāyato udakadhārā pavattati…pe… ekekalomakūpato aggikkhandho pavattati, ekekalomakūpato udakadhārā pavattati, channaṃ vaṇṇāna’’ntiādinayappavattaṃ yamakapāṭihāriyaṃ dasseti. Tassa suvaṇṇavaṇṇasarīrato suvaṇṇavaṇṇā rasmiyo uggantvā yāva bhavaggā gacchanti, sakaladasasahassacakkavāḷassa alaṅkaraṇakālo viya hoti, dutiyā dutiyā rasmiyo purimāya purimāya yamakayamakā viya ekakkhaṇe viya pavattanti.
The arising of two minds in a single moment does not exist. But for the Buddhas, the Blessed Ones, due to the lightness of their sojourn in the life-continuum and because of their mastery cultivated in five ways, they arise as if in a single moment. But the resolutions of reflecting, preparing, and determining for each ray are indeed separate.
Hai tâm không thể khởi lên trong cùng một sát-na. Nhưng đối với chư Phật Thế Tôn, do sự nhẹ nhàng của sự luân chuyển hữu phần (bhavaṅga) và sự thuần thục đã được thực hành qua năm cách, chúng dường như khởi lên trong cùng một sát-na. Tuy nhiên, sự tác ý, chuẩn bị và quyết định của mỗi tia sáng là riêng biệt.
Dvinnañca cittānaṃ ekakkhaṇe pavatti nāma natthi. Buddhānaṃ pana bhagavantānaṃ bhavaṅgaparivāsassa lahukatāya pañcahākārehi āciṇṇavasitāya ca, tā ekakkhaṇe viya pavattanti. Tassā tassā pana rasmiyā āvajjanaparikammādhiṭṭhānāni visuṃ visuṃyeva.
For for the sake of the blue rays the Blessed One attains to the blue-device absorption, for the yellow rays the yellow-device, for the red-and-white rays the red-and-white-device, for the mass of flames the fire-device, for the stream of water the water-device absorption. The Teacher walks, the created image stands, sits, or lies down – all should be explained in detail. Herein, there is not even a single function of morality, all is the function of concentration. Thus, morality does not attain concentration.
Để có tia sáng màu xanh, Đức Thế Tôn nhập thiền biến xứ xanh, để có tia sáng màu vàng, nhập thiền biến xứ vàng, để có tia sáng màu đỏ và trắng, nhập thiền biến xứ đỏ và trắng, để có ngọn lửa, nhập hỏa biến xứ, để có dòng nước, nhập thủy biến xứ. Đức Đạo Sư đi kinh hành, hóa thân đứng, ngồi, hoặc nằm, tất cả đều cần phải được trình bày chi tiết. Ở đây, không có một phận sự nào của giới cả, tất cả đều là phận sự của định. Như vậy, giới không đạt đến định.
Nīlarasmiatthāya hi bhagavā nīlakasiṇaṃ samāpajjati, pītarasmiatthāya pītakasiṇaṃ, lohitaodātarasmiatthāya lohitaodātakasiṇaṃ, aggikkhandhatthāya tejokasiṇaṃ, udakadhāratthāya āpokasiṇaṃ samāpajjati. Satthā caṅkamati, nimmito tiṭṭhati vā nisīdati vā seyyaṃ vā kappetīti sabbaṃ vitthāretabbaṃ. Ettha ekampi sīlassa kiccaṃ natthi, sabbaṃ samādhikiccameva. Evaṃ sīlaṃ samādhiṃ na pāpuṇāti.
But when the Blessed One, after fulfilling the perfections for four incalculable periods and a hundred thousand eons, renouncing his home in the twenty-ninth year which was like the dwelling of universal-monarch-splendor, having gone forth by the Anoma River, having engaged in the practice of striving for six years, having partaken of the honey-rice pudding containing divine nourishment offered by Sujata in Uruvela village on the full-moon day of Visakha, having in the evening entered the Bodhi-enclosure from the south-north side, having circumambulated the royal Assattha tree three times, having stood in the east-north part, having spread out a grass mat, having drawn up his legs in the triple-folded posture, having made the well-wishing meditation accompanied by the four limbs his preliminary practice, having determined to strive, having ascended the excellent fourteen-cubit throne which was like a silver column placed on a golden pedestal, having placed his back against the fifty-cubit Bodhi-trunk, which was like a silver column placed on a golden pedestal, being shaded above by the Bodhi-branches as if by a jeweled umbrella, with the golden-hued robes being showered upon by the coral-like Bodhi-shoots, as the sun was setting, having routed Mara's army, having recollected his former existences in the first watch, having purified the divine eye in the middle watch, having, at dawn, descended with knowledge into the causal process practiced by all Buddhas, having produced the fourth absorption of in-and-out breathing, having made that the basis, having increased insight, having extinguished all defilements by the fourth path attained by the path-progression, penetrated all the Buddha-qualities, this is his wisdom-function. Thus, concentration does not attain wisdom.
Hơn nữa, Đức Thế Tôn, sau khi viên mãn các Ba-la-mật trong bốn A-tăng-kỳ và một trăm ngàn đại kiếp, vào năm hai mươi chín tuổi, rời bỏ cung điện là nơi trú ngụ của vinh quang Chuyển Luân Thánh Vương, xuất gia tại bờ sông Anomā, thực hành khổ hạnh trong sáu năm, vào ngày rằm tháng Visākha, tại làng Uruvelā, thọ dụng bát cháo sữa do Sujātā cúng dường, có thêm sức mạnh chư thiên, vào buổi chiều, đi vào Bồ Đề Đạo Tràng theo hướng nam-bắc, đi nhiễu quanh cây Assattha (Bồ Đề) ba vòng, đứng ở phía đông-bắc, trải cỏ làm tọa cụ, kiết già với ba điểm tựa, lấy pháp hành từ (mettā) làm nền tảng, với bốn chi phần đầy đủ, quyết định tinh tấn, trên bảo tọa rộng mười bốn hắc-tay, lưng tựa vào thân cây Bồ Đề rộng năm mươi hắc-tay, như một thân cây bằng bạc đặt trên nền vàng, được che chở bởi các nhánh Bồ Đề như lọng bằng châu báu, trong khi những chồi Bồ Đề như san hô rơi trên y màu vàng, khi mặt trời lặn, Ngài hàng phục Ma quân, vào canh đầu hồi tưởng các đời sống quá khứ, vào canh giữa làm thanh tịnh thiên nhãn, vào canh cuối, nhập vào lý duyên khởi vốn là pháp mà chư Phật đã thực hành, chứng đắc thiền thứ tư của hơi thở vào ra, lấy đó làm nền tảng, tăng trưởng minh sát (vipassanā), nhờ sự thực hành theo đạo lộ, chứng đắc đạo thứ tư, đoạn trừ tất cả phiền não, chứng đắc tất cả các công đức của chư Phật, đây là phận sự của tuệ của Ngài. Như vậy, định không đạt đến tuệ.
Yaṃ pana bhagavā kappasatasahassādhikāni cattāri asaṅkhyeyyāni pāramiyo pūretvā, ekūnatiṃsavassakāle cakkavattisirīnivāsabhūtā bhavanā nikkhamma anomānadītīre pabbajitvā, chabbassāni padhānayogaṃ katvā, visākhapuṇṇamāyaṃ uruvelagāme sujātāya dinnaṃ pakkhittadibbojaṃ madhupāyāsaṃ paribhuñjitvā, sāyanhasamaye dakkhiṇuttarena bodhimaṇḍaṃ pavisitvā assatthadumarājānaṃ tikkhattuṃ padakkhiṇaṃ katvā, pubbuttarabhāge ṭhito tiṇasanthāraṃ santharitvā, tisandhipallaṅkaṃ ābhujitvā, caturaṅgasamannāgataṃ mettākammaṭṭhānaṃ pubbaṅgamaṃ katvā, vīriyādhiṭṭhānaṃ adhiṭṭhāya, cuddasahatthapallaṅkavaragato suvaṇṇapīṭhe ṭhapitaṃ rajatakkhandhaṃ viya paññāsahatthaṃ bodhikkhandhaṃ piṭṭhito katvā, upari maṇichattena viya bodhisākhāya dhāriyamāno, suvaṇṇavaṇṇe cīvare pavāḷasadisesu bodhiaṅkuresu patamānesu, sūriye atthaṃ upagacchante mārabalaṃ vidhamitvā, paṭhamayāme pubbenivāsaṃ anussaritvā, majjhimayāme dibbacakkhuṃ visodhetvā, paccūsakāle sabbabuddhānamāciṇṇe paccayākāre ñāṇaṃ otāretvā, ānāpānacatutthajjhānaṃ nibbattetvā, tadeva pādakaṃ katvā vipassanaṃ vaḍḍhetvā, maggapaṭipāṭiyā adhigatena catutthamaggena sabbakilese khepetvā sabbabuddhaguṇe paṭivijjhi, idamassa paññākiccaṃ. Evaṃ samādhi paññaṃ na pāpuṇāti.
Just as the water in the hand does not attain the water in the bowl, the water in the bowl does not attain the water in the jar, the water in the jar does not attain the water in the water-pot, the water in the water-pot does not attain the water in the large jar, the water in the large jar does not attain the water in the small well, the water in the small well does not attain the water in the cave, the water in the cave does not attain the water in the small river, the water in the small river does not attain the water in the five great rivers, the water in the five great rivers does not attain the water in the great world-system-ocean, the water in the great world-system-ocean does not attain the water in the great ocean at the foot of Mount Sineru. With reference to the water in the bowl, the water in the hand is small...with reference to the water in the great ocean at the foot of Mount Sineru, the water in the great world-system-ocean is small. Thus, with reference to each successive greater quantity of water, the preceding smaller quantity of water is minor.
Ở đây, ví như nước trong tay không bằng nước trong bát, nước trong bát không bằng nước trong ghè (bình), nước trong ghè không bằng nước trong lu, nước trong lu không bằng nước trong chậu, nước trong chậu không bằng nước trong vại lớn, nước trong vại lớn không bằng nước trong hồ cạn, nước trong hồ cạn không bằng nước trong vực sâu, nước trong vực sâu không bằng nước trong sông nhỏ, nước trong sông nhỏ không bằng nước trong năm con sông lớn, nước trong năm con sông lớn không bằng nước trong biển lớn bao quanh thế giới (cakkavāḷa), nước trong biển lớn bao quanh thế giới không bằng nước trong biển lớn ở chân núi Tu-di. Nước trong tay, so với nước trong bát thì ít… nước trong biển lớn bao quanh thế giới, so với nước trong biển lớn ở chân núi Tu-di thì ít. Như vậy, so với lượng nước nhiều hơn ở trên, lượng nước ở dưới là ít.
Tattha yathā hatthe udakaṃ pātiyaṃ udakaṃ na pāpuṇāti, pātiyaṃ udakaṃ ghaṭe udakaṃ na pāpuṇāti, ghaṭe udakaṃ kolambe udakaṃ na pāpuṇāti, kolambe udakaṃ cāṭiyaṃ udakaṃ na pāpuṇāti, cāṭiyaṃ udakaṃ mahākumbhiyaṃ udakaṃ na pāpuṇāti, mahākumbhiyaṃ udakaṃ kusobbhe udakaṃ na pāpuṇāti, kusobbhe udakaṃ kandare udakaṃ na pāpuṇāti, kandare udakaṃ kunnadiyaṃ udakaṃ na pāpuṇāti, kunnadiyaṃ udakaṃ pañcamahānadiyaṃ udakaṃ na pāpuṇāti, pañcamahānadiyaṃ udakaṃ cakkavāḷamahāsamudde udakaṃ na pāpuṇāti, cakkavāḷamahāsamudde udakaṃ sinerupādake mahāsamudde udakaṃ na pāpuṇāti. Pātiyaṃ udakaṃ upanidhāya hatthe udakaṃ parittaṃ…pe… sinerupādakamahāsamudde udakaṃ upanidhāya cakkavāḷamahāsamudde udakaṃ parittaṃ. Iti uparūpari udakaṃ bahukaṃ upādāya heṭṭhā heṭṭhā udakaṃ parittaṃ hoti.
Even so, with reference to each successive superior quality, the preceding morality is to be understood as small and inferior. Therefore he said: "This, monks, is a small, inferior thing, mere morality."
Tương tự như vậy, cần phải hiểu rằng, so với các công đức càng cao ở trên, thì giới càng thấp ở dưới là nhỏ bé, hạ liệt. Vì vậy, Ngài nói: "Này các Tỳ kheo, cái được gọi là giới ấy là nhỏ bé, hạ liệt, chỉ có giới mà thôi."
Evameva upari upari guṇe upādāya heṭṭhā heṭṭhā sīlaṃ appamattakaṃ oramattakanti veditabbaṃ. Tenāha – ‘‘appamattakaṃ kho panetaṃ, bhikkhave, oramattakaṃ sīlamattaka’’nti.
By a worldling, here —
*Yenaputhujjano* - Ở đây:
Yenaputhujjanoti, ettha –
"Two kinds of worldlings were spoken of by the Buddha, kinsman of the sun;
"Đức Phật, bậc thân tộc của mặt trời, đã dạy có hai hạng phàm phu;
‘‘Duve puthujjanā vuttā, buddhenādiccabandhunā;
The blind worldling is one, the good worldling is another."
Một là phàm phu অন্ধ (mù quáng), một là phàm phu thiện."
Andho puthujjano eko, kalyāṇeko puthujjano’’ti.
Herein, he who lacks inquiry, questioning, listening, retaining, and reviewing of aggregates, elements, sense bases, and so forth, this one is a blind worldling. He who has them is a good worldling. But both are —
Ở đây, ai không có sự học hỏi, tham vấn, nghe, ghi nhớ, quán sát về uẩn, xứ, giới, v.v., thì đó là phàm phu mù quáng. Ai có những điều ấy, thì đó là phàm phu thiện. Tuy nhiên, cả hai loại này:
Tattha yassa khandhadhātuāyatanādīsu uggahaparipucchāsavanadhāraṇapaccavekkhaṇāni natthi, ayaṃ andhaputhujjano. Yassa tāni atthi, so kalyāṇaputhujjano. Duvidhopi panesa –
"By various reasons, such as generating and so on, a worldling;
"Do các nguyên nhân sinh ra nhiều (phàm phu) v.v., nên gọi là phàm phu;
‘‘Puthūnaṃ jananādīhi, kāraṇehi puthujjano;
By inclusion within the multitude of worldlings, this is a multitude of people."
Do nằm trong số phàm phu, nên quần chúng này là phàm phu."
Puthujjanantogadhattā, puthuvāyaṃ jano iti’’.
He is indeed a worldling due to various reasons of generating and so on, various defilements and so forth. As he said:
Người ấy, do các nguyên nhân sinh ra nhiều (puthūnaṃ) phiền não khác nhau, v.v., nên là phàm phu. Như đã nói:
So hi puthūnaṃ nānappakārānaṃ kilesādīnaṃ jananādīhi kāraṇehi puthujjano. Yathāha –
"They generate numerous defilements, thus they are worldlings; they have not destroyed the belief in a personal-entity, thus they are worldlings; they gaze upon the faces of various teachers, thus they are worldlings; they have not emerged from all destinations, thus they are worldlings; they perform various kinds of accumulations, thus they are worldlings; they are carried away by various streams, they are scorched by various distresses, they are consumed by various fevers, they are infatuated, greedy, attached, obsessed, fallen into, stuck, clung to, and obstructed by the five strands of sense pleasures, thus they are worldlings; they are covered, cloaked, veiled, enveloped, concealed, and blocked by the five hindrances, thus they are worldlings." He is a worldling also due to inclusion within the multitude of people who are devoid of the noble qualities, who have passed beyond counting, who are averse to the noble teachings, who behave in base ways. That he is a worldling is to say that he is distinctly categorized as separate, unmixed with noble people endowed with virtues such as morality and learning.
"Vì sinh ra nhiều phiền não nên là phàm phu, vì không diệt trừ thân kiến (sakkāyadiṭṭhi) nên là phàm phu, vì ngưỡng mộ nhiều bậc thầy nên là phàm phu, vì chưa ra khỏi tất cả các nẻo ác nên là phàm phu, vì tạo tác nhiều hành khác nhau nên là phàm phu, bị cuốn trôi bởi nhiều dòng nước, bị thiêu đốt bởi nhiều sự nóng bức, bị thiêu đốt bởi nhiều sự nóng bức, tham đắm, say mê, dính mắc, chấp trước, vướng mắc, bị trói buộc trong năm dục, bị bao phủ, che đậy, che lấp, bịt kín, bao trùm, úp chụp bởi năm triền cái nên là phàm phu." Cũng là phàm phu vì nằm trong số những người xa rời diệu pháp, thực hành các pháp thấp kém, vượt quá số lượng, phàm phu này được tính riêng, khác biệt, không hòa lẫn với các bậc Thánh có giới, nghe nhiều v.v.
‘‘Puthu kilese janentīti puthujjanā, puthu avihatasakkāyadiṭṭhikāti puthujjanā, puthu satthārānaṃ mukhullokikāti puthujjanā, puthu sabbagatīhi avuṭṭhitāti puthujjanā, puthu nānābhisaṅkhāre abhisaṅkharontīti puthujjanā, puthu nānāoghehi vuyhanti, puthu santāpehi santappanti, puthu pariḷāhehi pariḍayhanti, puthu pañcasu kāmaguṇesu rattā giddhā gathitā mucchitā ajjhopannā laggā laggitā palibuddhāti puthujjanā, puthu pañcahi nīvaraṇehi āvutā nivutā ovutā pihitā paṭicchannā paṭikujjitāti puthujjanā’’ti. Puthūnaṃ gaṇanapathamatītānaṃ ariyadhammaparammukhānaṃ nīcadhammasamācārānaṃ janānaṃ antogadhattāpi puthujjano, puthuvāyaṃ visuṃyeva saṅkhyaṃ gato visaṃsaṭṭho sīlasutādiguṇayuttehi ariyehi janehīti puthujjanoti.
Of the Thus-Gone One: In eight ways, the Blessed One is the Thus-Gone One. He is Thus-Gone One because he has come thus, because he has gone thus, because he has come to the characteristics of reality, because he has become perfectly enlightened to the real phenomena, because he sees thus, because he speaks thus, because he acts thus, and because of the sense of overcoming, he is Thus-Gone One.
*Tathāgatassa* - Đức Thế Tôn là Như Lai vì tám lý do. *Tathā āgato* (đến như vậy) nên là Như Lai, *tathā gato* (đi như vậy) nên là Như Lai, *tathalakkhaṇaṃ āgato* (đến với các đặc tính như vậy) nên là Như Lai, *tathadhamme yāthāvato abhisambuddhoti* (chứng ngộ chân thật các pháp như vậy) nên là Như Lai, *tathadassitāya* (thấy như vậy) nên là Như Lai, *tathavāditāya* (nói như vậy) nên là Như Lai, *tathākāritāya* (làm như vậy) nên là Như Lai, *abhibhavanaṭṭhena* (vượt trội) nên là Như Lai.
Tathāgatassāti aṭṭhahi kāraṇehi bhagavā tathāgato. Tathā āgatoti tathāgato, tathā gatoti tathāgato, tathalakkhaṇaṃ āgatoti tathāgato, tathadhamme yāthāvato abhisambuddhoti tathāgato, tathadassitāya tathāgato, tathavāditāya tathāgato, tathākāritāya tathāgato, abhibhavanaṭṭhena tathāgatoti.
How is the Blessed One, thus come, the Tathāgata? As the former perfect Buddhas who were zealous for the welfare of the whole world came, as the Blessed One Vipassī came, as the Blessed One Sikhī, as the Blessed One Vessabhū, as the Blessed One Kakusandha, as the Blessed One Koṇāgamana, as the Blessed One Kassapa came. What is meant by this? By whatever aspiration these Blessed Ones came, by that very same our Blessed One came. Or else, as the Blessed One Vipassī…as the Blessed One Kassapa, having fulfilled the perfection of generosity, having fulfilled the perfections of virtue, renunciation, wisdom, energy, patience, truthfulness, determination, loving-kindness, and equanimity; having fulfilled these ten perfections, ten near-perfections, ten ultimate perfections, that is thirty perfections; having made the five great sacrifices, that is, the sacrifice of limbs, eyes, wealth, kingdom, and the sacrifice of sons and wife; having fulfilled such things as the practice of prior conduct, the practice of prior actions, the explanation of the Dhamma, benefiting relatives, and having reached the summit of the practice conducive to Buddhahood, he came; thus, our Blessed One came. Or else, as the Blessed One Vipassī…as the Blessed One Kassapa, having cultivated and developed the four foundations of mindfulness, the four right efforts, the four bases of spiritual power, the five faculties, the five powers, the seven factors of enlightenment, and the noble eightfold path, he came; thus, our Blessed One came. Thus, “thus come” is the Tathāgata.
Như thế nào là bậc Như Lai (Tathāgata) vì đã đến như thế (tathā āgata)? Như chư vị Sammāsambuddhā (Phật Chánh Đẳng Giác) trong quá khứ đã đến, khởi lên vì lòng mong cầu lợi ích cho tất cả thế gian, như Đức Thế Tôn Vipassī (Tỳ-bà-thi) đã đến, như Đức Thế Tôn Sikhī (Thi-khí), như Đức Thế Tôn Vessabhū (Tỳ-xá-phù), như Đức Thế Tôn Kakusandha (Câu-lưu-tôn), như Đức Thế Tôn Koṇāgamana (Câu-na-hàm-mâu-ni), như Đức Thế Tôn Kassapa (Ca-diếp) đã đến. Điều này có nghĩa là gì? Các Đức Thế Tôn ấy đã đến với sự tinh cần như thế nào, Đức Thế Tôn của chúng ta cũng đã đến như thế ấy. Hoặc giả, như Đức Thế Tôn Vipassī... cho đến... như Đức Thế Tôn Kassapa đã viên mãn hạnh bố thí ba-la-mật, trì giới, xuất ly, trí tuệ, tinh tấn, nhẫn nhục, chân thật, quyết định, từ ái, xả ba-la-mật, đã viên mãn mười ba-la-mật này, mười cận ba-la-mật, mười chí thượng ba-la-mật như vậy là ba mươi ba-la-mật, đã xả ly sự bố thí các bộ phận thân thể, bố thí con mắt, của cải, quốc độ, con trai và vợ, đã xả ly năm sự đại bố thí này, đã viên mãn những công hạnh như thuyết giảng về pháp hành trì thuở xưa (Pubbayogapubbacariyadhammakkhāna), thực hành vì lợi ích cho thân bằng quyến thuộc (ñātatthacariyā), đã đạt đến đỉnh cao của sự thực hành vì giác ngộ (buddhicariyā); Đức Thế Tôn của chúng ta cũng đã đến như thế. Hoặc giả, như Đức Thế Tôn Vipassī... cho đến... như Đức Thế Tôn Kassapa đã tu tập và phát triển bốn niệm xứ (satipaṭṭhāna), bốn chánh cần (sammappadhāna), bốn như ý túc (iddhipāda), năm căn (indriya), năm lực (bala), bảy chi phần giác ngộ (bojjhaṅga), Bát Chánh Đạo (ariya aṭṭhaṅgika magga); Đức Thế Tôn của chúng ta cũng đã đến như thế. Như vậy là bậc Như Lai vì đã đến như thế.
Kathaṃ bhagavā tathā āgatoti tathāgato? Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā, yathā vipassī bhagavā āgato, yathā sikhī bhagavā, yathā vessabhū bhagavā, yathā kakusandho bhagavā, yathā koṇāgamano bhagavā, yathā kassapo bhagavā āgato . Kiṃ vuttaṃ hoti? Yena abhinīhārena ete bhagavanto āgatā, teneva amhākampi bhagavā āgato. Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā dānapāramiṃ pūretvā, sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramiṃ pūretvā, imā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsapāramiyo pūretvā aṅgapariccāgaṃ, nayanadhanarajjaputtadārapariccāganti ime pañca mahāpariccāge pariccajitvā pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā buddhicariyāya koṭiṃ patvā āgato; tathā amhākampi bhagavā āgato. Atha vā yathā vipassī bhagavā…pe… kassapo bhagavā cattāro satipaṭṭhāne, cattāro sammappadhāne, cattāro iddhipāde, pañcindriyāni, pañca balāni, satta bojjhaṅge, ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvetvā brūhetvā āgato, tathā amhākampi bhagavā āgato. Evaṃ tathā āgatoti tathāgato.
"Just as Vipassī and the others in the world,
"Như chư vị Vipassi (Tỳ-bà-thi) trong thế gian,
‘‘Yatheva lokamhi vipassiādayo,
Attained to omniscience, thus the sages have come here;
Các bậc Muni (Mâu-ni) đã đạt Nhất Thiết Trí;
Sabbaññubhāvaṃ munayo idhāgatā;
Thus, this Sakyan sage also has come,
Như vậy vị Sakyamuni (Thích-ca Mâu-ni) này đã đến,
Tathā ayaṃ sakyamunīpi āgato,
Therefore, the One with Vision is called the Tathāgata."
Bậc có Mắt (Cakkhumā) được gọi là Như Lai bởi thế."
Tathāgato vuccati tena cakkhumā’’ti.
Thus, “thus come” is the Tathāgata.
Như vậy là bậc Như Lai vì đã đến như thế.
Evaṃ tathā āgatoti tathāgato.
How is "thus gone" the Tathāgata? As the newly-born Blessed One Vipassī went...as the Blessed One Kassapa went.
Như thế nào là bậc Như Lai vì đã đi như thế (tathā gata)? Như Đức Thế Tôn Vipassī vừa mới sinh ra đã đi... cho đến... Đức Thế Tôn Kassapa đã đi.
Kathaṃ tathā gatoti tathāgato? Yathā sampatijāto vipassī bhagavā gato…pe… kassapo bhagavā gato.
And how did that Blessed One go? He, just born, standing firmly on the ground with even feet, went with seven strides facing north. As he said: “Just born, Ānanda, the Bodhisatta, standing firmly on the ground with even feet, goes with seven strides facing north, while a white umbrella is held over him, he looks around in all directions and speaks with a lordly voice: ‘I am the chief in the world, I am the best in the world, I am the foremost in the world, this is the last birth, now there is no more rebirth’"(D. II. 31).
Và Đức Thế Tôn ấy đã đi như thế nào? Ngài vừa mới sinh ra liền đứng vững trên mặt đất bằng hai bàn chân bằng phẳng, hướng mặt về phương Bắc đi bảy bước. Như đã nói – "Này Ānanda (A-nan), Bồ Tát (Bodhisatta) vừa mới sinh ra, liền đứng vững trên mặt đất bằng hai bàn chân bằng phẳng, hướng mặt về phương Bắc đi bảy bước, trong khi lọng trắng được che lên, Ngài nhìn khắp mọi phương, nói lời của bậc Ngưu Vương (āsabhiṃ vācaṃ) – 'Ta là bậc tối thượng trong thế gian, Ta là bậc trưởng thượng trong thế gian, Ta là bậc tối tôn trong thế gian, đây là đời sống cuối cùng, không còn tái sinh nữa'" (Trường Bộ Kinh 2.31).
Kathañca so bhagavā gato ? So hi sampati jātova samehi pādehi pathaviyaṃ patiṭṭhāya uttarābhimukho sattapadavītihārena gato. Yathāha – ‘‘sampatijāto kho, ānanda, bodhisatto samehi pādehi patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati, setamhi chatte anudhāriyamāne sabbā ca disā anuviloketi, āsabhiṃ vācaṃ bhāsati – ‘aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthidāni punabbhavo’ti’’ (dī. ni. 2.31).
And was his going thus? It was not otherwise, as a pre-indication of many attainments of special qualities. For the fact that he just born, stood firmly with even feet on the earth. This is a pre-indication of his attainment of the four bases of spiritual power.
Và sự đi ấy của Ngài có phải là như thật (tatha)? Thật, không sai khác, là điềm báo trước (pubbanimitta) của sự chứng đắc nhiều quả vị thù thắng. Vì Ngài vừa mới sinh ra liền đứng vững trên mặt đất bằng hai bàn chân bằng phẳng. Đây là điềm báo trước của sự chứng đắc bốn như ý túc (iddhipāda).
Tañcassa gamanaṃ tathaṃ ahosi? Avitathaṃ anekesaṃ visesādhigamānaṃ pubbanimittabhāvena. Yañhi so sampatijātova samehi pādehi patiṭṭhahi. Idamassa caturiddhipādapaṭilābhassa pubbanimittaṃ.
His facing north is a pre-indication of his being above the whole world.
Việc hướng mặt về phương Bắc là điềm báo trước của địa vị tối thượng trong tất cả thế gian.
Uttarābhimukhabhāvo pana sabbalokuttarabhāvassa pubbanimittaṃ.
The seven strides, of his attainment of the seven jewels of enlightenment.
Việc đi bảy bước, là điềm báo trước của sự chứng đắc bảy báu giác chi (bojjhaṅgaratana).
Sattapadavītihāro, sattabojjhaṅgaratanapaṭilābhassa.
The lifting up of the yak-tail fans mentioned in the words, "Golden-handled yak-tail fans were waved," is a pre-indication of his crushing of all sectarians.
Việc phất tịnh trần (vĩ) bằng cán bằng vàng, như được nói "Cây phất trần với cán bằng vàng bay phất phới", là điềm báo trước của việc hàng phục tất cả ngoại đạo (titthiya).
‘‘Suvaṇṇadaṇḍā vītipatanti cāmarā’’ti, ettha vuttacāmarukkhepo pana sabbatitthiyanimmaddanassa.
The holding of the white umbrella, of his attainment of the excellent, supreme, pure white umbrella of liberation through Arahatship.
Việc che lọng trắng, là điềm báo trước của sự chứng đắc lọng trắng vô thượng thanh tịnh thù thắng giải thoát (arahattavimutti).
Setacchattadhāraṇaṃ, arahattavimuttivaravimalasetacchattapaṭilābhassa.
His standing on the seventh stride and looking around in all directions, of his attainment of the unobstructed knowledge of omniscience.
Việc đứng lại sau bảy bước và nhìn khắp mọi phương, là điềm báo trước của sự chứng đắc trí tuệ Nhất Thiết Chủng không bị ngăn che (sabbaññutā).
Sattamapadūpari ṭhatvā sabbadisānuvilokanaṃ, sabbaññutānāvaraṇañāṇapaṭilābhassa.
His speaking with a lordly voice, is a pre-indication of his turning of the supreme wheel of the Dhamma which cannot be turned back.
Việc nói lời của bậc Ngưu Vương, là điềm báo trước của sự chuyển Pháp Luân (dhammacakka) vô thượng, không ai cản được.
Āsabhivācābhāsanaṃ appaṭivattiyavaradhammacakkappavattanassa pubbanimittaṃ.
Thus, this Blessed One also went, and his going was thus, not otherwise, by being a pre-indication of those very attainments of special qualities.
Đức Thế Tôn của chúng ta cũng đã đi như vậy, và sự đi ấy của Ngài là như thật, không sai khác, là điềm báo trước của chính những sự chứng đắc các quả vị thù thắng ấy.
Tathā ayaṃ bhagavāpi gato, tañcassa gamanaṃ tathaṃ ahosi, avitathaṃ, tesaṃyeva visesādhigamānaṃ pubbanimittabhāvena.
Therefore, the ancients said:
Bởi vậy, các bậc cổ đức nói –
Tenāhu porāṇā –
"Just as a newly born bull,
"Như con bò chúa (gavampati) vừa mới sinh,
‘‘Muhuttajātova gavampatī yathā,
He touched the earth with even feet;
Đứng vững trên mặt đất bằng hai bàn chân bằng phẳng;
Samehi pādehi phusī vasundharaṃ;
The Gotama walked seven steps,
Gotama (Cồ-đàm) ấy bước đi bảy bước,
So vikkamī satta padāni gotamo,
And the devas held a white umbrella.
Chư thiên (marū) che lọng trắng."
Setañca chattaṃ anudhārayuṃ marū.
Having walked the seven steps, the Gotama,
"Gotama (Cồ-đàm) ấy đi bảy bước,
Gantvāna so satta padāni gotamo,
Looked around at the equal directions,
Ngài nhìn khắp mọi phương, bình đẳng;
Disā vilokesi samā samantato;
And uttered a speech endowed with eight qualities,
Ngài nói lên lời nói gồm đủ tám chi,
Aṭṭhaṅgupetaṃ giramabbhudīrayi,
Like a lion situated on the top of a mountain."
Như sư tử đứng trên đỉnh núi."
Sīho yathā pabbatamuddhaniṭṭhito’’ti.
Thus, "thus gone" is the Tathāgata.
Như vậy là bậc Như Lai vì đã đi như thế.
Evaṃ tathā gatoti tathāgato.
Or else, as the Blessed One Vipassī...as the Blessed One Kassapa, this Blessed One also having abandoned sensual desire through renunciation, has gone; having abandoned ill-will through non-ill-will; having abandoned sloth and torpor through the perception of light; having abandoned restlessness and remorse through non-distraction; having abandoned doubt through the determination of phenomena; having destroyed ignorance through knowledge; having dispelled discontent through joy; having opened the door of the fetters with the first jhāna; having calmed down thought-conception and discursive thought with the second jhāna; having abandoned rapture with the third jhāna; having abandoned pleasure and pain with the fourth jhāna; having transcended the perceptions of form, the perceptions of resistance, and the perceptions of diversity through the attainment to the base of the infinity of space; having transcended the perception of the base of the infinity of space through the attainment to the base of the infinity of consciousness; having transcended the perception of the base of the infinity of consciousness through the attainment to the base of nothingness; having transcended the perception of the base of nothingness through the attainment to the base of neither-perception-nor-non-perception, has gone.
Hoặc giả, như Đức Thế Tôn Vipassī... cho đến... như Đức Thế Tôn Kassapa, Đức Thế Tôn này cũng đã đi như thế, sau khi đã xả ly tham dục (kāmacchanda) bằng xuất ly (nekkhamma), đã xả ly sân hận (byāpāda) bằng vô sân (abyāpādena), hôn trầm thụy miên (thīnamiddha) bằng quang tưởng (ālokasaññā), trạo hối (uddhaccakukkucca) bằng sự không tán loạn (avikkhepa), hoài nghi (vicikicchā) bằng sự xác định rõ về pháp (dhammavavatthāna), sau khi đã làm tan biến vô minh (avijjā) bằng trí tuệ (ñāṇa), đã xả ly bất mãn (arati) bằng hỷ (pāmojja), đã mở toang cánh cửa chướng ngại (nīvaraṇakavāṭa) bằng Sơ Thiền (paṭhamajjhāna), đã làm cho tầm và tứ (vitakkavicāra) an tịnh bằng Nhị Thiền (dutiyajjhāna), đã làm cho hỷ (pīti) hết sức mạnh bằng Tam Thiền (tatiyajjhāna), đã xả ly lạc và khổ (sukhadukkha) bằng Tứ Thiền (catutthajjhāna), đã vượt qua sắc tưởng, đối ngại tưởng và dị tưởng (rūpasaññāpaṭighasaññānānattasaññā) bằng Không Vô Biên Xứ Định (ākāsānañcāyatanasamāpatti), Không Vô Biên Xứ tưởng (ākāsānañcāyatanasañña) bằng Thức Vô Biên Xứ Định (viññāṇañcāyatanasamāpatti), Thức Vô Biên Xứ tưởng (viññāṇañcāyatanasañña) bằng Vô Sở Hữu Xứ Định (ākiñcaññāyatanasamāpatti), Vô Sở Hữu Xứ tưởng (ākiñcaññāyatanasañña) bằng Phi Tưởng Phi Phi Tưởng Xứ Định (nevasaññānāsaññāyatanasamāpatti).
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ pahāya gato , abyāpādena byāpādaṃ, ālokasaññāya thinamiddhaṃ, avikkhepena uddhaccakukkuccaṃ, dhammavavatthānena vicikicchaṃ pahāya ñāṇena avijjaṃ padāletvā, pāmojjena aratiṃ vinodetvā, paṭhamajjhānena nīvaraṇakavāṭaṃ ugghāṭetvā, dutiyajjhānena vitakkavicāraṃ vūpasametvā, tatiyajjhānena pītiṃ virājetvā, catutthajjhānena sukhadukkhaṃ pahāya, ākāsānañcāyatanasamāpattiyā rūpasaññāpaṭighasaññānānattasaññāyo samatikkamitvā, viññāṇañcāyatanasamāpattiyā ākāsānañcāyatanasaññaṃ, ākiñcaññāyatanasamāpattiyā viññāṇañcāyatanasaññaṃ, nevasaññānāsaññāyatanasamāpattiyā ākiñcaññāyatanasaññaṃ samatikkamitvā gato.
Having abandoned the perception of permanence through the contemplation of impermanence; having abandoned the perception of pleasure through the contemplation of suffering; having abandoned the perception of self through the contemplation of not-self; having abandoned delight through the contemplation of disenchantment; having abandoned lust through the contemplation of dispassion; having abandoned origination through the contemplation of cessation; having abandoned grasping through the contemplation of relinquishment; having abandoned the perception of compactness through the contemplation of decay; having abandoned accumulation through the contemplation of dissolution; having abandoned the perception of permanence through the contemplation of change; having abandoned the sign through the contemplation of the signless; having abandoned longing through the contemplation of the desireless; having abandoned adherence through the contemplation of emptiness; having abandoned adherence to the adoption of the essence through the contemplation of phenomena with higher wisdom; having abandoned adherence to delusion through the knowledge and vision of things as they really are; having abandoned adherence to clinging through the contemplation of danger; having abandoned non-reflection through the contemplation of reflection; having abandoned adherence to connection through the contemplation of turning away; having smashed the fetters connected with wrong view with the path of stream-entry; having abandoned the gross fetters with the path of once-returning; having uprooted the fetters accompanied by latent tendencies with the path of non-returning; having completely cut off all fetters with the path of Arahatship, has gone. Thus too, "thus gone" is the Tathāgata.
Sau khi đã xả ly thường tưởng (niccasañña) bằng quán vô thường (aniccānupassanā), lạc tưởng (sukhasañña) bằng quán khổ (dukkhānupassanā), ngã tưởng (attasañña) bằng quán vô ngã (anattānupassanā), hoan hỷ (nandi) bằng quán yểm ly (nibbidānupassanā), tham (rāga) bằng quán ly tham (virāgānupassanā), tập khởi (samudaya) bằng quán đoạn diệt (nirodhānupassanā), chấp thủ (ādāna) bằng quán xả ly (paṭinissaggānupassanā), trọng tưởng (ghanasañña) bằng quán hoại diệt (khayānupassanā), tích tập (āyūhana) bằng quán tiêu vong (vayānupassanā), thường còn tưởng (dhuvasañña) bằng quán biến hoại (vipariṇāmānupassanā), tướng (nimitta) bằng quán vô tướng (animittānupassanā), ước muốn (paṇidhi) bằng quán vô nguyện (appaṇihitānupassanā), chấp trước (abhinivesa) bằng quán không tánh (suññatānupassanā), chấp trước vào tinh túy (sārādānābhinivesa) bằng thắng pháp quán (adhipaññādhammavipassanā), chấp trước vào mê mờ (sammohābhinivesa) bằng như thật tri kiến (yathābhūtañāṇadassana), chấp trước vào ưa thích (ālayābhinivesa) bằng quán nguy hại (ādīnavānupassanā), không tư duy (appaṭisaṅkha) bằng quán tư duy (paṭisaṅkhānupassanā), chấp trước vào kết hợp (saṃyogābhinivesa) bằng quán xoay chuyển (vivaṭṭānupassanā), sau khi đã đập tan các phiền não thuộc kiến (diṭṭhekaṭṭhe) bằng Tu-đà-hoàn Đạo (sotāpattimagga), đã xả ly các phiền não thô (oḷārike) bằng Tư-đà-hàm Đạo (sakadāgāmimagga), đã nhổ tận gốc các phiền não vi tế (aṇusahagata) bằng A-na-hàm Đạo (anāgāmimagga), đã đoạn trừ tất cả phiền não bằng A-la-hán Đạo (arahattamagga). Như vậy cũng là bậc Như Lai vì đã đi như thế.
Aniccānupassanāya niccasaññaṃ pahāya, dukkhānupassanāya sukhasaññaṃ, anattānupassanāya attasaññaṃ, nibbidānupassanāya nandiṃ, virāgānupassanāya rāgaṃ, nirodhānupassanāya samudayaṃ, paṭinissaggānupassanāya ādānaṃ, khayānupassanāya ghanasaññaṃ, vayānupassanāya āyūhanaṃ, vipariṇāmānupassanāya dhuvasaññaṃ, animittānupassanāya nimittaṃ, appaṇihitānupassanāya paṇidhiṃ, suññatānupassanāya abhinivesaṃ, adhipaññādhammavipassanāya sārādānābhinivesaṃ, yathābhūtañāṇadassanena sammohābhinivesaṃ, ādīnavānupassanāya ālayābhinivesaṃ, paṭisaṅkhānupassanāya appaṭisaṅkhaṃ, vivaṭṭānupassanāya saṃyogābhinivesaṃ, sotāpattimaggena diṭṭhekaṭṭhe kilese bhañjitvā, sakadāgāmimaggena oḷārike kilese pahāya, anāgāmimaggena aṇusahagate kilese samugghāṭetvā, arahattamaggena sabbakilese samucchinditvā gato. Evampi tathā gatoti tathāgato.
How is “having come to the such-like characteristics” the Tathāgata? In the earth element the characteristic of hardness is such, not otherwise. In the water element, the characteristic of flowing. In the fire element, the characteristic of heat. In the wind element, the characteristic of distending. In the space element, the characteristic of non-contact. In the consciousness element, the characteristic of cognizing.
Như thế nào là bậc Như Lai vì đã đến với đặc tánh như thật (tathalakkhaṇa)? Đặc tánh cứng (kakkhaḷatta) của địa đại (pathavīdhātu) là như thật, không sai khác. Đặc tánh chảy (paggharaṇa) của thủy đại (āpodhātu). Đặc tánh nóng (uṇhatta) của hỏa đại (tejodhātu). Đặc tánh phồng (vitthambhana) của phong đại (vāyodhātu). Đặc tánh không xúc chạm (asamphuṭṭha) của không đại (ākāsadhātu). Đặc tánh biết (vijānana) của thức đại (viññāṇadhātu).
Kathaṃ tathalakkhaṇaṃ āgatoti tathāgato?Pathavīdhātuyā kakkhaḷattalakkhaṇaṃ tathaṃ avitathaṃ. Āpodhātuyā paggharaṇalakkhaṇaṃ. Tejodhātuyā uṇhattalakkhaṇaṃ. Vāyodhātuyā vitthambhanalakkhaṇaṃ. Ākāsadhātuyā asamphuṭṭhalakkhaṇaṃ. Viññāṇadhātuyā vijānanalakkhaṇaṃ.
In materiality, the characteristic of being molested. In feeling, the characteristic of being felt. In perception, the characteristic of perceiving. In formations, the characteristic of forming. In consciousness, the characteristic of cognizing.
Đặc tánh hay làm cho hư hoại (ruppana) của sắc (rūpa). Đặc tánh cảm giác (vedayita) của thọ (vedanā). Đặc tánh nhận biết đối tượng (sañjānana) của tưởng (saññā). Đặc tánh tạo tác (abhisaṅkharaṇa) của các hành (saṅkhāra). Đặc tánh biết (vijānana) của thức (viññāṇa).
Rūpassa ruppanalakkhaṇaṃ. Vedanāya vedayitalakkhaṇaṃ. Saññāya sañjānanalakkhaṇaṃ. Saṅkhārānaṃ abhisaṅkharaṇalakkhaṇaṃ. Viññāṇassa vijānanalakkhaṇaṃ.
In thought-conception, the characteristic of applying. In discursive thought, the characteristic of examining. In rapture, the characteristic of pervading. In happiness, the characteristic of being pleasant. In one-pointedness of mind, the characteristic of non-distraction. In contact, the characteristic of touching.
Đặc tánh hướng đến đối tượng (abhiniropana) của tầm (vitakka). Đặc tánh xoa dịu (anumajjana) của tứ (vicāra). Đặc tánh tràn ngập (pharaṇa) của hỷ (pīti). Đặc tánh khả ái (sāta) của lạc (sukha). Đặc tánh không tán loạn (avikkhepa) của nhất tâm (cittekaggatā). Đặc tánh xúc chạm (phusana) của xúc (phassa).
Vitakkassa abhiniropanalakkhaṇaṃ. Vicārassa anumajjanalakkhaṇaṃ pītiyā pharaṇalakkhaṇaṃ. Sukhassa sātalakkhaṇaṃ. Cittekaggatāya avikkhepalakkhaṇaṃ. Phassassa phusanalakkhaṇaṃ.
In the faculty of faith, the characteristic of resolving. In the faculty of energy, the characteristic of exerting. In the faculty of mindfulness, the characteristic of standing near. In the faculty of concentration, the characteristic of non-distraction. In the faculty of wisdom, the characteristic of understanding.
Đặc tánh tin tưởng (adhimokkha) của tín căn (saddhindriya). Đặc tánh tinh cần (paggaha) của tấn căn (vīriyindriya). Đặc tánh an trú (upaṭṭhāna) của niệm căn (satindriya). Đặc tánh không tán loạn (avikkhepa) của định căn (samādhindriya). Đặc tánh liễu tri (pajānana) của tuệ căn (paññindriya).
Saddhindriyassa adhimokkhalakkhaṇaṃ. Vīriyindriyassa paggahalakkhaṇaṃ. Satindriyassa upaṭṭhānalakkhaṇaṃ. Samādhindriyassa avikkhepalakkhaṇaṃ. Paññindriyassa pajānanalakkhaṇaṃ.
In the power of faith, the characteristic of being unshakeable by lack of faith. In the power of energy, by laziness; in the power of mindfulness, by forgetfulness. In the power of concentration, by restlessness; in the power of wisdom, the characteristic of being unshakeable by ignorance.
Đặc tánh không dao động bởi bất tín (assaddhiye akampiya) của tín lực (saddhābala). Của tấn lực (vīriyabala) đối với biếng nhác (kosajja), của niệm lực (satibala) đối với thất niệm (muṭṭhassacca). Của định lực (samādhibala) đối với trạo cử (uddhacca), đặc tánh không dao động bởi vô minh (avijjāya akampiya) của tuệ lực (paññābala).
Saddhābalassa assaddhiye akampiyalakkhaṇaṃ. Vīriyabalassa kosajje, satibalassa muṭṭhassacce. Samādhibalassa uddhacce, paññābalassa avijjāya akampiyalakkhaṇaṃ.
In the enlightenment factor of mindfulness, the characteristic of standing near. In the enlightenment factor of investigation of phenomena, the characteristic of investigating. In the enlightenment factor of energy, the characteristic of exerting. In the enlightenment factor of rapture, the characteristic of pervading. In the enlightenment factor of tranquility, the characteristic of calming down. In the enlightenment factor of concentration, the characteristic of non-distraction. In the enlightenment factor of equanimity, the characteristic of reflecting.
Đặc tánh an trú (upaṭṭhāna) của niệm giác chi (satisambojjhaṅga). Đặc tánh trạch pháp (pavicaya) của trạch pháp giác chi (dhammavicayasambojjhaṅga). Đặc tánh tinh cần (paggaha) của tinh tấn giác chi (vīriyasambojjhaṅga). Đặc tánh tràn ngập (pharaṇa) của hỷ giác chi (pītisambojjhaṅga). Đặc tánh an tịnh (vūpasama) của khinh an giác chi (passaddhisambojjhaṅga). Đặc tánh không tán loạn (avikkhepa) của định giác chi (samādhisambojjhaṅga). Đặc tánh suy xét (paṭisaṅkhāna) của xả giác chi (upekkhāsambojjhaṅga).
Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ. Dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ. Vīriyasambojjhaṅgassa paggahalakkhaṇaṃ. Pītisambojjhaṅgassa pharaṇalakkhaṇaṃ. Passaddhisambojjhaṅgassa vūpasamalakkhaṇaṃ. Samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ. Upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.
In right view, the characteristic of seeing. In right thought, the characteristic of applying. In right speech, the characteristic of restraining. In right action, the characteristic of originating. In right livelihood, the characteristic of purifying. In right effort, the characteristic of exerting. In right mindfulness, the characteristic of standing near. In right concentration, the characteristic of non-distraction.
Đặc tánh thấy (dassana) của chánh kiến (sammādiṭṭhi). Đặc tánh hướng đến đối tượng (abhiniropana) của chánh tư duy (sammāsaṅkappa). Đặc tánh chấp trì (pariggaha) của chánh ngữ (sammāvācā). Đặc tánh làm cho sanh khởi (samuṭṭhāna) của chánh nghiệp (sammākammanta). Đặc tánh làm cho thanh tịnh (vodāna) của chánh mạng (sammāājīva). Đặc tánh tinh cần (paggaha) của chánh tinh tấn (sammāvāyāma). Đặc tánh an trú (upaṭṭhāna) của chánh niệm (sammāsati). Đặc tánh không tán loạn (avikkhepa) của chánh định (sammāsamādhi).
Sammādiṭṭhiyā dassanalakkhaṇaṃ. Sammāsaṅkappassa abhiniropanalakkhaṇaṃ. Sammāvācāya pariggahalakkhaṇaṃ. Sammākammantassa samuṭṭhānalakkhaṇaṃ. Sammāājīvassa vodānalakkhaṇaṃ. Sammāvāyāmassa paggahalakkhaṇaṃ. Sammāsatiyā upaṭṭhānalakkhaṇaṃ. Sammāsamādhissa avikkhepalakkhaṇaṃ.
In ignorance, the characteristic of unknowing. In formations, the characteristic of volition. In consciousness, the characteristic of cognizing. In mentality, the characteristic of bending. In materiality, the characteristic of being molested. In the six sense-bases, the characteristic of being a base. In contact, the characteristic of touching. In feeling, the characteristic of being felt. In craving, the characteristic of being a cause. In clinging, the characteristic of grasping. In existence, the characteristic of accumulating. In birth, the characteristic of producing. In aging, the characteristic of decaying. In death, the characteristic of passing away.
Đặc tánh không biết (aññāṇa) của vô minh (avijjā). Đặc tánh tác ý (cetanā) của các hành (saṅkhāra). Đặc tánh biết (vijānana) của thức (viññāṇa). Đặc tánh hướng đến (namana) của danh (nāma). Đặc tánh hư hoại (ruppana) của sắc (rūpa). Đặc tánh là nơi phát sinh (āyatana) của lục nhập (saḷāyatana). Đặc tánh xúc chạm (phusana) của xúc (phassa). Đặc tánh cảm giác (vedayita) của thọ (vedanā). Đặc tánh là nhân (hetu) của ái (taṇhā). Đặc tánh nắm giữ (gahaṇa) của thủ (upādāna). Đặc tánh tích lũy (āyūhana) của hữu (bhava). Đặc tánh sinh (nibbattilakkhaṇa) của sinh (jāti). Đặc tánh suy yếu (jīraṇa) của già (jarā). Đặc tánh diệt (cutilakkhaṇa) của sự chết (maraṇa).
Avijjāya aññāṇalakkhaṇaṃ. Saṅkhārānaṃ cetanālakkhaṇaṃ. Viññāṇassa vijānanalakkhaṇaṃ. Nāmassa namanalakkhaṇaṃ. Rūpassa ruppanalakkhaṇaṃ. Saḷāyatanassa āyatanalakkhaṇaṃ. Phassassa phusanalakkhaṇaṃ. Vedanāya vedayitalakkhaṇaṃ. Taṇhāya hetulakkhaṇaṃ. Upādānassa gahaṇalakkhaṇaṃ. Bhavassa āyūhanalakkhaṇaṃ. Jātiyā nibbattilakkhaṇaṃ. Jarāya jīraṇalakkhaṇaṃ. Maraṇassa cutilakkhaṇaṃ.
Of the elements, the characteristic of emptiness. Of the sense-bases, the characteristic of being a sense-base. Of the foundations of mindfulness, the characteristic of attending. Of the right strivings, the characteristic of exertion. Of the bases of spiritual power, the characteristic of succeeding. Of the faculties, the characteristic of mastery. Of the strengths, the characteristic of being unshakable. Of the enlightenment factors, the characteristic of leading out. Of the path, the characteristic of being a cause.
Các hành xứ (dhātu) có tướng trạng là trống không. Các xứ (āyatana) có tướng trạng là xứ. Các niệm xứ (satipaṭṭhāna) có tướng trạng là an trú. Các tinh cần (sammappadhāna) có tướng trạng là tinh tấn. Các thần túc (iddhipāda) có tướng trạng là thành tựu. Các căn (indriya) có tướng trạng là chủ động. Các lực (bala) có tướng trạng là không dao động. Các chi phần giác ngộ (bojjhaṅga) có tướng trạng là đưa đến giải thoát. Đạo (magga) có tướng trạng là nhân.
Dhātūnaṃ suññatālakkhaṇaṃ. Āyatanānaṃ āyatanalakkhaṇaṃ. Satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ. Sammappadhānānaṃ padahanalakkhaṇaṃ. Iddhipādānaṃ ijjhanalakkhaṇaṃ. Indriyānaṃ adhipatilakkhaṇaṃ. Balānaṃ akampiyalakkhaṇaṃ. Bojjhaṅgānaṃ niyyānalakkhaṇaṃ. Maggassa hetulakkhaṇaṃ.
Of the truths, the characteristic of suchness. Of tranquility, the characteristic of non-distraction. Of insight, the characteristic of seeing again and again. Of tranquility and insight, the characteristic of having a single taste. Of being yoked together, the characteristic of non-transgression.
Các sự thật (sacca) có tướng trạng là như vậy. Chỉ (samatha) có tướng trạng là không tán loạn. Quán (vipassanā) có tướng trạng là tùy quán. Chỉ và Quán (samathavipassanā) có tướng trạng là đồng một vị. Sự kết hợp (yuganaddha) có tướng trạng là không vượt qua.
Saccānaṃ tathalakkhaṇaṃ. Samathassa avikkhepalakkhaṇaṃ. Vipassanāya anupassanālakkhaṇaṃ. Samathavipassanānaṃ ekarasalakkhaṇaṃ. Yuganaddhānaṃ anativattanalakkhaṇaṃ.
Of the purification of virtue, the characteristic of restraint. Of the purification of mind, the characteristic of non-distraction. Of the purification of view, the characteristic of seeing.
Giới thanh tịnh (sīlavisuddhi) có tướng trạng là phòng hộ. Tâm thanh tịnh (cittavisuddhi) có tướng trạng là không tán loạn. Kiến thanh tịnh (diṭṭhivisuddhi) có tướng trạng là thấy.
Sīlavisuddhiyā saṃvaralakkhaṇaṃ. Cittavisuddhiyā avikkhepalakkhaṇaṃ. Diṭṭhivisuddhiyā dassanalakkhaṇaṃ.
Of knowledge in destruction, the characteristic of cutting off. Of knowledge in non-arising, the characteristic of tranquility.
Trí về đoạn diệt (khaye ñāṇa) có tướng trạng là cắt đứt hoàn toàn. Trí về không sinh khởi (anuppāde ñāṇa) có tướng trạng là an tịnh.
Khaye ñāṇassa samucchedanalakkhaṇaṃ. Anuppāde ñāṇassa passaddhilakkhaṇaṃ.
Of desire, the characteristic of being the root. Of attention, the characteristic of initiating. Of contact, the characteristic of converging. Of feeling, the characteristic of confluence. Of concentration, the characteristic of prominence. Of mindfulness, the characteristic of dominance. Of wisdom, the characteristic of that which is higher. Of liberation, the characteristic of essence… of the deathless-immersed Nibbāna, the characteristic of final culmination is such, not unreal. Thus, one who has arrived by the course of knowledge, the characteristic of suchness, having obtained it without fail, having attained the unattained is the Thus-gone (Tathāgata). Thus, one who has arrived, the characteristic of suchness, is the Thus-gone (Tathāgata).
Dục (chanda) có tướng trạng là gốc rễ. Tác ý (manasikāra) có tướng trạng là khởi đầu. Xúc (phassa) có tướng trạng là tập hợp. Thọ (vedanā) có tướng trạng là hội tụ. Định (samādhi) có tướng trạng là đứng đầu. Niệm (sati) có tướng trạng là tối thượng. Tuệ (paññā) có tướng trạng là vượt lên trên. Giải thoát (vimutti) có tướng trạng là cốt tủy… Niết-bàn (nibbāna) hướng đến bất tử có tướng trạng là cứu cánh, chân thật, không hư dối. Như vậy, Như Lai là bậc đã đến, đã đạt được, đã chứng đắc một cách hoàn toàn không sai lệch, trí tuệ đi đến tướng trạng chân thật như vậy. Như Lai là bậc đã đến với tướng trạng chân thật như vậy.
Chandassa mūlalakkhaṇaṃ. Manasikārassa samuṭṭhāpanalakkhaṇaṃ. Phassassa samodhānalakkhaṇaṃ. Vedanāya samosaraṇalakkhaṇaṃ. Samādhissa pamukhalakkhaṇaṃ. Satiyā ādhipateyyalakkhaṇaṃ. Paññāya tatuttariyalakkhaṇaṃ. Vimuttiyā sāralakkhaṇaṃ… amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ. Evaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato. Evaṃ tathalakkhaṇaṃ āgatoti tathāgato.
How is he the Thus-gone (Tathāgata) through being perfectly awakened to the real states as they are? The real states are the four noble truths. As he said: "These four, monks, are real, not unreal, not otherwise. What four? 'This is suffering,' monks, this is real, not unreal, not otherwise," (Saṃ. Ni. 5.1090) and so on in detail. And the Blessed One is fully awakened to them, therefore, because of being perfectly awakened to those states of reality, he is called the Thus-gone (Tathāgata). Here the word "gone" has the meaning of perfectly awakened.
Như Lai là bậc đã giác ngộ hoàn toàn các pháp chân thật một cách đúng như thật như thế nào? Các pháp chân thật chính là bốn Thánh Đế. Như đã nói – "Này các Tỳ-kheo, có bốn điều này là chân thật, không hư dối, không khác. Thế nào là bốn? 'Đây là khổ', này các Tỳ-kheo, là chân thật, không hư dối, không khác" (Tương Ưng Bộ Kinh V.1090) và phần mở rộng. Và bậc Thế Tôn đã giác ngộ hoàn toàn các pháp đó, vì vậy Ngài được gọi là Như Lai, vì đã giác ngộ hoàn toàn các pháp chân thật. Ở đây, từ "đã đến" có nghĩa là đã giác ngộ.
Kathaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato? Tathadhammā nāma cattāri ariyasaccāni. Yathāha – ‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni. Katamāni cattāri? ‘Idaṃ dukkha’nti bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1090) vitthāro. Tāni ca bhagavā abhisambuddho, tasmā tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati. Abhisambuddhattho hettha gatasaddo.
And also, the fact that aging-and-death is conditioned by birth, arisen from it, originating from it, is such, not unreal, not otherwise… and so on…, the fact that formations are conditioned by ignorance, arisen from it, originating from it, is such, not unreal, not otherwise… and so on…, thus the fact that formations are conditioned by ignorance, the fact that consciousness is conditioned by formations… and so on…, the fact that aging-and-death is conditioned by birth, is such, not unreal, not otherwise. The Blessed One is fully awakened to all of that, therefore, because of being perfectly awakened to those states of reality, he is called the Thus-gone (Tathāgata). Thus, he is the Thus-gone (Tathāgata) through being perfectly awakened to the real states as they are.
Và nữa, tướng trạng của già và chết do duyên sinh, do tập khởi, do hợp lại là chân thật, không hư dối, không khác…; tướng trạng của các hành (saṅkhāra) do duyên vô minh, do tập khởi, do hợp lại là chân thật, không hư dối, không khác…; tướng trạng của vô minh là duyên cho các hành, tướng trạng của các hành là duyên cho thức,…, tướng trạng của sinh là duyên cho già và chết, là chân thật, không hư dối, không khác. Tất cả điều đó đã được bậc Thế Tôn giác ngộ hoàn toàn, vì vậy Ngài được gọi là Như Lai, vì đã giác ngộ hoàn toàn các pháp chân thật. Như vậy, Như Lai là bậc đã giác ngộ hoàn toàn các pháp chân thật một cách đúng như thật.
Api ca jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, tathā avijjāya saṅkhārānaṃ paccayaṭṭho, saṅkhārānaṃ viññāṇassa paccayaṭṭho…pe…, jātiyā jarāmaraṇassa paccayaṭṭho tatho avitatho anaññatho. Taṃ sabbaṃ bhagavā abhisambuddho, tasmāpi tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati. Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.
How is he the Thus-gone (Tathāgata) through having seen things as they really are? Whatever visual object comes into the range of the eye-door of the immeasurable beings in the immeasurable world-spheres in the world with its devas… and so on… including the realm of devas and humans, the Blessed One knows and sees that in all its aspects. And in knowing and seeing thus, whether by way of its being pleasant, unpleasant, etc., or by way of the categories obtainable in the seen, heard, sensed, and cognized. "What is that form, that form sense-base? That form which is a derivative of the four great elements, color, shape, visible, impingent, blue, yellow," and so on (Dha. Sa. 616) in this manner, by many names, or in thirteen instances, classified in fifty-two ways, it is exactly so, there is nothing unreal in it. This method also applies to sound and so on, coming into the range of the ear-door and so on. And this was stated by the Blessed One: "That, monks, which in the world with its devas… and so on… including the realm of devas and humans, is seen, heard, sensed, cognized, attained, sought after, pondered over by the mind, I know that. I have fully understood that, that is known to the Thus-gone (Tathāgata), the Thus-gone (Tathāgata) did not settle for that."(A. Ni. 4.24). Thus, he is the Thus-gone (Tathāgata) through having seen things as they really are. Here, the derivation of the word should be understood as, in the sense of having seen suchness, Thus-gone (Tathāgata).
Như Lai là bậc đã thấy chân thật như thế nào? Trong thế giới bao gồm chư thiên… cho đến chúng sinh gồm chư thiên và loài người, trong các thế giới vô lượng, đối với vô lượng chúng sinh, bất cứ đối tượng sắc nào đi vào con đường mắt, Ngài đều biết và thấy tất cả một cách toàn diện. Và do biết và thấy như vậy, hoặc do đối tượng đó là đáng ưa hay không đáng ưa, hoặc do các phương diện có thể đạt được trong cái thấy, cái nghe, cái cảm nhận, cái được biết. "Sắc nào là sắc xứ? Sắc là sự nương nhờ của bốn đại, có màu sắc hình dáng, có thể thấy được, có chướng ngại, màu xanh, màu vàng" (Dhammasaṅgaṇī, 616) v.v., theo cách này, bằng nhiều tên gọi, hoặc bằng mười ba cách, hoặc bằng năm mươi hai cách phân chia, nó vẫn là chân thật như vậy, không có gì là hư dối. Cách này cũng áp dụng cho âm thanh… đi vào con đường tai, v.v. Điều này đã được bậc Thế Tôn nói – "Này các Tỳ-kheo, điều gì mà thế giới bao gồm chư thiên… cho đến chúng sinh gồm chư thiên và loài người, đã thấy, đã nghe, đã cảm nhận, đã được biết, đã đạt được, đã tìm cầu, đã được ý suy tư, Ta đều biết. Ta đã biết rõ, Như Lai đã thông suốt, Như Lai đã không chấp trước" (Anguttara Nikāya IV.24). Như Lai là bậc đã thấy chân thật như vậy. Ở đây, cần phải hiểu rằng, nguồn gốc của từ Như Lai là ở trong ý nghĩa Như Lai là bậc đã thấy chân thật.
Kathaṃ tathadassitāya tathāgato? Bhagavā yaṃ sadevake loke…pe…, sadevamanussāya pajāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthamāgacchantaṃ rūpārammaṇaṃ nāma atthi, taṃ sabbākārato jānāti passati. Evaṃ jānatā passatā ca, tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā. ‘‘Katamaṃ taṃ rūpaṃ rūpāyatanaṃ? Yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītaka’’ntiādinā (dha. sa. 616) nayena anekehi nāmehi terasahi vārehi dvepaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi. Esa nayo sotadvārādīsupi āpāthaṃ āgacchantesu saddādīsu. Vuttañcetaṃ bhagavatā – ‘‘yaṃ bhikkhave, sadevakassa lokassa…pe… sadevamanussāya pajāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi. Tamahaṃ abbhaññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ti (a. ni. 4.24). Evaṃ tathadassitāya tathāgato. Tattha tathadassī atthe tathāgatoti padasambhavo veditabbo.
How is he the Thus-gone (Tathāgata) because of speaking the truth? From the night the Blessed One, sitting on the undefeated seat at the foot of the Bodhi tree, crushed the heads of the three Māras and became fully awakened to the unsurpassed perfect awakening, to the night when he passed away into the element of Nibbāna without residue between the twin Sal trees – during this period of forty-five years, whether it be early awakening, middle awakening, or late awakening, whatever was spoken by the Blessed One – Discourse, mixed prose and verse… and so on… the section on full understanding – all that is blameless in meaning and phrasing, neither deficient nor excessive, perfect in all aspects, crushing the intoxication of passion, crushing the intoxication of ill will and delusion. There is not even a hair's breadth that is flawed; all that is as if sealed with a single seal, as if measured in a single tube, as if weighed on a single scale, it is exactly so, not unreal, not otherwise. Therefore, he said: "Cunda, from the night the Thus-gone (Tathāgata) becomes fully awakened to the unsurpassed perfect awakening, to the night he passes away into the element of Nibbāna without residue, whatever he speaks, utters, declares during that interval, all that is exactly so, not otherwise. Therefore, he is called the 'Thus-gone (Tathāgata)'." (A. Ni. 4.23). Here the word "gone" has the meaning of "spoken". Thus, he is the Thus-gone (Tathāgata) because of speaking the truth.
Như Lai là bậc đã nói chân thật như thế nào? Đêm mà bậc Thế Tôn ngồi trên tòa Kim Cương bất khả chiến bại dưới cội Bồ-đề, nghiền nát đầu của ba Ma vương, giác ngộ Vô Thượng Chánh Đẳng Giác, và đêm mà Ngài nhập Niết-bàn Vô Dư Y, giữa hai cây Sala song thọ, trong khoảng thời gian bốn mươi lăm năm này, dù là ở giai đoạn đầu giác ngộ, giai đoạn giữa giác ngộ, hay giai đoạn cuối giác ngộ, bất cứ điều gì được bậc Thế Tôn nói – Kinh, Ứng tụng… cho đến Phương quảng, tất cả đều không thể bác bỏ, không thiếu, không thừa, hoàn hảo về mọi phương diện, cả về nghĩa và về văn, là sự dập tắt tham dục, là sự dập tắt sân hận và si mê. Không có một chút mảy may nào là sai lệch, tất cả đều như được đóng dấu bằng một con dấu, như được đo bằng một ống đo, như được cân bằng một cái cân, nó vẫn là chân thật như vậy, không hư dối, không khác. Vì vậy, Ngài nói – "Này Cunda, đêm mà Như Lai giác ngộ Vô Thượng Chánh Đẳng Giác, và đêm mà Như Lai nhập Niết-bàn Vô Dư Y, bất cứ điều gì trong khoảng thời gian này được nói, được tuyên bố, được chỉ dạy, tất cả đều là chân thật như vậy, không khác. Vì vậy, được gọi là ‘Như Lai’" (Anguttara Nikāya IV.23). Ở đây, từ "đã đến" có nghĩa là đã nói. Như Lai là bậc đã nói chân thật như vậy.
Kathaṃ tathavāditāya tathāgato? Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno tiṇṇaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ – suttaṃ, geyyaṃ…pe… vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anupavajjaṃ, anūnamanadhikaṃ, sabbākāraparipuṇṇaṃ, rāgamadanimmadanaṃ, dosamohamadanimmadanaṃ. Natthi tattha vālaggamattampi avakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷiyā mitaṃ viya, ekatulāya tulitaṃ viya ca, tathameva hoti avitathaṃ anaññathaṃ. Tenāha – ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tatheva hoti, no aññathā. Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23). Gadattho hettha gatasaddo. Evaṃ tathavāditāya tathāgato.
And also, the meaning is arrival of arrivals, spoken word. The three unperverted arrivals of him, changing "da" to "ta", thus, Thus-gone (Tathāgata), thus should the word-formation in this meaning be understood.
Và nữa, “đã đến” là “đã đi đến”, nghĩa là đã nói. “Ba sự đi đến không điên đảo của Ngài”, ở đây, biến chữ “da” thành chữ “ta”, Như Lai, sự hình thành từ ngữ trong nghĩa này cần phải được hiểu.
Api ca āgadanaṃ āgado, vacananti attho. Tayo aviparīto āgado assāti, da-kārassa ta-kāraṃ katvā tathāgatoti evametasmiṃ atthe padasiddhi veditabbā.
How is he the Thus-gone (Tathāgata) because of acting accordingly? For the Blessed One's body conforms to his speech, and his speech to his body, therefore he speaks as he acts, and acts as he speaks. And for one who is thus, the meaning is that as his speech is, so his body has also gone, has proceeded. And as his body is, so his speech has also gone, has proceeded, Thus-gone (Tathāgata). Therefore he said: "As he speaks, monks, so the Thus-gone (Tathāgata) acts, as he acts, so he speaks. Thus, as he speaks, so he acts, as he acts, so he speaks. Therefore, he is called the 'Thus-gone (Tathāgata)'."(A. Ni. 4.23). Thus, he is the Thus-gone (Tathāgata) because of acting accordingly.
Như Lai là bậc đã làm chân thật như thế nào? Vì thân của bậc Thế Tôn thuận theo lời nói, và lời nói thuận theo thân, vì vậy, Ngài nói như thế nào thì làm như thế ấy, làm như thế nào thì nói như thế ấy. Và đối với bậc như vậy, như lời nói, thân cũng đi đến, hành động theo như vậy. Và như thân, lời nói cũng đi đến, hành động theo như vậy, là Như Lai. Vì vậy, Ngài nói – "Này các Tỳ-kheo, Như Lai nói như thế nào thì làm như thế ấy, làm như thế nào thì nói như thế ấy. Như vậy, nói như thế nào thì làm như thế ấy, làm như thế nào thì nói như thế ấy. Vì vậy, được gọi là ‘Như Lai’" (Anguttara Nikāya IV.23). Như Lai là bậc đã làm chân thật như vậy.
Kathaṃ tathākāritāya tathāgato? Bhagavato hi vācāya kāyo anulometi, kāyassapi vācā, tasmā yathāvādī tathākārī, yathākārī tathāvādī ca hoti. Evaṃbhūtassa cassa yathāvācā, kāyopi tathā gato pavattoti attho. Yathā ca kāyo, vācāpi tathā gatā pavattāti tathāgato. Tenevāha – ‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī . Iti yathāvādī tathākārī yathākārī tathāvādī. Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23). Evaṃ tathākāritāya tathāgato.
How is he the Thus-gone (Tathāgata) in the sense of overcoming? Taking the summit of existence above and the Avīci hell below as limits, and transversely in the immeasurable world-spheres, he overcomes all beings by virtue, by concentration, by wisdom, by liberation, and by the knowledge and vision of liberation. There is no comparison or measure for him; he is incomparable, immeasurable, unsurpassed, the king of kings, the god of gods, supreme among the Sakyans, supreme among the Brahmās. Therefore he said: "In the world with its devas, monks… and so on… including the realm of devas and humans, the Thus-gone (Tathāgata) is the overcomer, the un-overcome, the seer of all things, the wielder of power. Therefore, he is called the 'Thus-gone (Tathāgata)'."
Như Lai là bậc vượt trội theo nghĩa nào? Từ cõi trời cao nhất đến địa ngục A-tỳ làm giới hạn, và theo chiều ngang, trong các thế giới vô lượng, Ngài vượt trội hơn tất cả chúng sinh về giới, về định, về tuệ, về giải thoát, về giải thoát tri kiến, không có gì có thể so sánh hay đo lường với Ngài; Ngài là bậc vô song, vô lượng, vô thượng, vua của các vua, chư thiên của các chư thiên, vượt trên các vị trời Đế Thích, vượt trên các vị Phạm Thiên. Vì vậy, Ngài nói – "Này các Tỳ-kheo, trong thế giới bao gồm chư thiên… cho đến chúng sinh gồm chư thiên và loài người, Như Lai là bậc vượt trội, không bị vượt trội, là bậc thấy rõ mọi sự, là bậc tự tại, vì vậy được gọi là ‘Như Lai’".
Kathaṃ abhibhavanaṭṭhena tathāgato? Upari bhavaggaṃ heṭṭhā avīciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati sīlenapi samādhināpi paññāyapi vimuttiyāpi, vimuttiñāṇadassanenapi na tassa tulā vā pamāṇaṃ vā atthi; atulo appameyyo anuttaro rājātirājā devadevo sakkānaṃ atisakko brahmānaṃ atibrahmā. Tenāha – ‘‘sadevake, bhikkhave, loke…pe… sadevamanussāya pajāya tathāgato abhibhū anabhibhūto aññadatthudaso vasavattī, tasmā ‘tathāgato’ti vuccatī’’ti.
Here, the formation of the word should thus be understood. Remedy is like a remedy. And what is this? It is both the splendor of his teaching and the accumulation of merit. By this, this highly powerful physician, with the divine remedy, overcomes all opponents' doctrines and the world with its devas, like snakes. Thus, in the overcoming of the entire world, the splendor of his teaching and the accumulation of merit are the unperverted remedy of him. Changing the "da" to "ta", it should be understood as Thus-gone (Tathāgata). Thus, he is the Thus-gone (Tathāgata) in the sense of overcoming.
Ở đây, sự hình thành từ ngữ cần phải được hiểu như vậy. Thuốc (agada) giống như thuốc. Nhưng thuốc này là gì? Đó là vẻ đẹp của sự thuyết pháp và sự tích lũy công đức. Vì vậy, bậc có đại oai lực này, như một thầy thuốc, vượt trội hơn tất cả những người theo ngoại đạo và thế giới bao gồm chư thiên, như rắn được thuần phục bởi thuốc thần. Như vậy, trong sự vượt trội hơn tất cả thế giới, vẻ đẹp của sự thuyết pháp và sự tích lũy công đức chân thật, không điên đảo của Ngài, là thuốc. Biến chữ “da” thành chữ “ta”, cần phải hiểu là Như Lai. Như Lai là bậc vượt trội theo nghĩa như vậy.
Tatrevaṃ padasiddhi veditabbā. Agado viya agado. Ko panesa? Desanāvilāsamayo ceva puññussayo ca. Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati. Iti sabbālokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññussayo ca agado assāti. Da-kārassa ta-kāraṃ katvā tathāgatoti veditabbo. Evaṃ abhibhavanaṭṭhena tathāgato.
And also, one gone to suchness is Thus-gone (Tathāgata), one who has gone thus is Thus-gone (Tathāgata). Gone is understood, passed beyond, attained, entered upon, is the meaning.
Và nữa, Như Lai là bậc đã đi đến với chân lý, Như Lai là bậc đã đi vào chân lý. "Đã đi" nghĩa là đã thông suốt, đã vượt qua, đã đạt được, đã thực hành.
Api ca tathāya gatotipi tathāgato, tathaṃ gatotipi tathāgato. Gatoti avagato, atīto patto paṭipannoti attho.
Here, he is the Thus-gone (Tathāgata), gone, understood, to suchness by the full understanding that crosses over the entire world. He is the Thus-gone (Tathāgata), gone, passed beyond, to suchness by the full understanding of abandoning the origin of the world. He is the Thus-gone (Tathāgata), gone, attained, to suchness by the realization of the cessation of the world. He is the Thus-gone (Tathāgata), gone, entered upon, suchness, which is the path leading to the cessation of the world. Therefore, it was said by the Blessed One:
Ở đây, Như Lai là bậc đã đi đến, đã thông suốt với chân lý, bằng sự hiểu biết rốt ráo về khổ đế. Như Lai là bậc đã đi đến, đã vượt qua với chân lý, bằng sự hiểu biết đoạn tận về tập đế. Như Lai là bậc đã đi đến, đã đạt được với chân lý, bằng sự chứng ngộ diệt đế. Như Lai là bậc đã đi vào, đã thực hành chân lý, đạo đưa đến diệt đế. Vì vậy, bậc Thế Tôn đã nói:
Tattha sakalalokaṃ tīraṇapariññāya tathāya gato avagatoti tathāgato. Lokasamudayaṃ pahānapariññāya tathāya gato atītoti tathāgato. Lokanirodhaṃ sacchikiriyāya tathāya gato pattoti tathāgato. Lokanirodhagāminiṃ paṭipadaṃ tathaṃ gato paṭipannoti tathāgato. Tena vuttaṃ bhagavatā –
"The world, monks, has been fully understood by the Thus-gone (Tathāgata); the Thus-gone (Tathāgata) is detached from the world. The origin of the world, monks, has been fully understood by the Thus-gone (Tathāgata); the origin of the world has been abandoned by the Thus-gone (Tathāgata). The cessation of the world, monks, has been fully understood by the Thus-gone (Tathāgata); the cessation of the world has been realized by the Thus-gone (Tathāgata). The path leading to the cessation of the world, monks, has been fully understood by the Thus-gone (Tathāgata); the path leading to the cessation of the world has been developed by the Thus-gone (Tathāgata). That, monks, which in the world with its devas… and so on… all that has been fully understood by the Thus-gone (Tathāgata). Therefore, he is called the 'Thus-gone (Tathāgata)'." (A. Ni. 4.23).
‘‘Khổ, này các Tỳ-kheo, Như Lai đã giác ngộ hoàn toàn, Như Lai đã thoát khỏi khổ. Tập, này các Tỳ-kheo, Như Lai đã giác ngộ hoàn toàn, tập đã được Như Lai đoạn tận. Diệt, này các Tỳ-kheo, Như Lai đã giác ngộ hoàn toàn, diệt đã được Như Lai chứng ngộ. Đạo đưa đến diệt, này các Tỳ-kheo, Như Lai đã giác ngộ hoàn toàn, đạo đưa đến diệt đã được Như Lai tu tập. Điều gì mà thế giới bao gồm chư thiên… tất cả điều đó Như Lai đã giác ngộ hoàn toàn. Vì vậy, được gọi là ‘Như Lai’’’ (Anguttara Nikāya IV.23).
‘‘Loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto. Lokasamudayo, bhikkhave, tathāgatena abhisambuddho, lokasamudayo tathāgatassa pahīno. Lokanirodho, bhikkhave, tathāgatena abhisambuddho, lokanirodho tathāgatassa sacchikato. Lokanirodhagāminī paṭipadā, bhikkhave, tathāgatena abhisambuddhā, lokanirodhagāminī paṭipadā tathāgatassa bhāvitā. Yaṃ bhikkhave, sadevakassa lokassa…pe… sabbaṃ taṃ tathāgatena abhisambuddhaṃ. Tasmā, tathāgatoti vuccatī’’ti (a. ni. 4.23).
Its meaning should be understood thus. This is just a glimpse into demonstrating the Tathagata's true nature. Only the Tathagata himself could fully describe the Tathagata's true nature in all aspects.
Ý nghĩa của nó nên được hiểu như vậy. Và điều này cũng chỉ là một phần nhỏ để cho thấy sự toàn giác của Như Lai. Chỉ có Như Lai mới có thể tán dương sự toàn giác của Như Lai bằng tất cả mọi phương diện.
Tassapi evaṃ attho veditabbo. Idampi ca tathāgatassa tathāgatabhāvadīpane mukhamattameva. Sabbākārena pana tathāgatova tathāgatassa tathāgatabhāvaṃ vaṇṇeyya.
"And what is that?" asks about what limited, basic aspects of virtue an ordinary person might praise about the Tathagata. There are five types of questions: questions seeking to illuminate the unknown, questions comparing what is known, questions clearing up doubt, questions seeking agreement, and questions asked wishing to explain.
"Này các Tỳ kheo, cái gì vậy?" (Kinh hỏi:) Phàm phu khi nói lời tán dương Như Lai, thì nói lời tán dương về giới nhỏ nhặt, ít ỏi nào? Ở đây, câu hỏi có năm loại: câu hỏi làm sáng tỏ điều chưa thấy, câu hỏi đối chiếu điều đã thấy, câu hỏi đoạn trừ nghi hoặc, câu hỏi chấp thuận, và câu hỏi với mong muốn được nói.
Katamañca taṃ bhikkhaveti yena appamattakena oramattakena sīlamattakena puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyya, taṃ katamanti pucchati? Tattha pucchā nāma adiṭṭhajotanā pucchā, diṭṭhasaṃsandanā pucchā, vimaticchedanā pucchā, anumatipucchā, kathetukamyatā pucchāti pañcavidhā hoti.
What is a question seeking to illuminate the unknown? When characteristics are naturally unknown, unseen, unweighed, unjudged, unclear and unrevealed, one asks questions to know, see, weigh, judge and reveal them. This is a question seeking to illuminate the unknown.
Trong đó, thế nào là câu hỏi làm sáng tỏ điều chưa thấy? Bản chất tự nhiên vốn không được biết đến, không được thấy, không được cân nhắc, không được suy xét, không được hiển lộ, không được phân tích rõ ràng. Vì muốn biết, muốn thấy, muốn cân nhắc, muốn suy xét, muốn làm cho hiển lộ, muốn phân tích rõ ràng điều đó, nên đặt câu hỏi. Đây là câu hỏi làm sáng tỏ điều chưa thấy.
Tattha katamā adiṭṭhajotanā pucchā? Pakatiyā lakkhaṇaṃ aññātaṃ hoti, adiṭṭhaṃ atulitaṃ atīritaṃ avibhūtaṃ avibhāvitaṃ, tassa ñāṇāya dassanāya tulanāya tīraṇāya vibhāvanāya pañhaṃ pucchati, ayaṃ adiṭṭhajotanā pucchā.
What is a question comparing what is known? When characteristics are naturally known, seen, weighed, judged, clear and revealed, one asks questions to compare them with other wise ones. This is a question comparing what is known.
Thế nào là câu hỏi đối chiếu điều đã thấy? Bản chất tự nhiên vốn được biết đến, đã được thấy, đã được cân nhắc, đã được suy xét, đã được hiển lộ, đã được phân tích rõ ràng. Vì muốn đối chiếu điều đó với các bậc trí giả khác, nên đặt câu hỏi. Đây là câu hỏi đối chiếu điều đã thấy.
Katamā diṭṭhasaṃsandanā pucchā? Pakatiyā lakkhaṇaṃ ñātaṃ hoti, diṭṭhaṃ tulitaṃ tīritaṃ vibhūtaṃ vibhāvitaṃ, tassa aññehi paṇḍitehi saddhiṃ saṃsandanatthāya pañhaṃ pucchati, ayaṃ diṭṭhasaṃsandanā pucchā.
What is a question clearing up doubt? When one is naturally inclined to uncertainty and doubt, of two minds thinking "Is it so or not? What is it? How is it?" One asks questions to clear up that doubt. This is a question clearing up doubt.
Thế nào là câu hỏi đoạn trừ nghi hoặc? Theo khuynh hướng của sự hoài nghi, theo khuynh hướng của sự lưỡng lự, do dự, (suy nghĩ) "có như vậy chăng, không như vậy chăng, là gì chăng, như thế nào chăng?". Vị ấy vì muốn đoạn trừ nghi hoặc nên đặt câu hỏi. Đây là câu hỏi đoạn trừ nghi hoặc.
Katamā vimaticchedanā pucchā? Pakatiyā saṃsayapakkhando hoti, vimatipakkhando, dveḷhakajāto, ‘‘evaṃ nu kho, na nu kho, kinnu kho, kathaṃ nu kho’’ti. So vimaticchedanatthāya pañhaṃ pucchati. Ayaṃ vimaticchedanā pucchā.
What is a question seeking agreement? The Blessed One asks monks questions seeking their agreement: "What do you think, monks - is form permanent or impermanent?" "Impermanent, venerable sir." "And is what is impermanent suffering or happiness?" "Suffering, venerable sir." Everything should be stated thus. This is a question seeking agreement.
Thế nào là câu hỏi chấp thuận? Đức Thế Tôn đặt câu hỏi theo sự chấp thuận của chư Tỳ kheo – "Các ông nghĩ thế nào, này các Tỳ kheo, sắc là thường hay vô thường?". "Bạch Thế Tôn, là vô thường." "Cái gì vô thường, cái đó là khổ hay là lạc?" "Bạch Thế Tôn, là khổ." (Đại Phẩm, 21) Tất cả nên được nói như vậy. Đây là câu hỏi chấp thuận.
Katamā anumatipucchā? Bhagavā bhikkhūnaṃ anumatiyā pañhaṃ pucchati – ‘‘taṃ kiṃ maññatha, bhikkhave, rūpaṃ niccaṃ vā aniccaṃ vā’’ti. Aniccaṃ, bhante. Yaṃ panāniccaṃ , dukkhaṃ vā taṃ sukhaṃ vāti? Dukkhaṃ bhanteti (mahāva. 21) sabbaṃ vattabbaṃ, ayaṃ anumatipucchā.
What is a question asked wishing to explain? The Blessed One asks monks questions wishing to explain: "Monks, there are these four foundations of mindfulness. What are the four?...Monks, there are these eight path factors. What are the eight?" This is a question asked wishing to explain.
Thế nào là câu hỏi với mong muốn được nói? Đức Thế Tôn đặt câu hỏi với mong muốn được nói cho chư Tỳ kheo. "Này các Tỳ kheo, có bốn niệm xứ này. Bốn là những gì?... (v.v...) Này các Tỳ kheo, có tám chi phần của đạo này. Tám là những gì?". Đây là câu hỏi với mong muốn được nói.
Katamā kathetukamyatā pucchā? Bhagavā bhikkhūnaṃ kathetukamyatāya pañhaṃ pucchati. Cattārome, bhikkhave, satipaṭṭhānā. Katame cattāro?…Pe… aṭṭhime bhikkhave maggaṅgā. Katame aṭṭhāti, ayaṃ kathetukamyatā pucchā.
Among these five types of questions, since there is nothing unknown to the Tathagata, he has no questions seeking to illuminate the unknown. Since the thought "I will teach this comparing it with other wise ascetics and brahmins" never arises, he has no questions comparing what is known. And since Buddhas have no hesitation or uncertainty about any phenomenon, having cut off all doubt at the seat of enlightenment, they also have no questions clearing up doubt. However, Buddhas do have the remaining two types of questions, and this is a question asked wishing to explain.
Như vậy, trong năm loại câu hỏi này, trước hết, vì không có bất kỳ pháp nào chưa được thấy đối với Như Lai, nên không có câu hỏi làm sáng tỏ điều chưa thấy. Vì ý nghĩ "ta sẽ thuyết giảng điều này sau khi đối chiếu với các bậc trí giả, Sa-môn, Bà-la-môn khác" không khởi lên, nên cũng không có câu hỏi đối chiếu điều đã thấy. Hơn nữa, vì chư Phật không có sự đeo bám, bám víu vào một pháp nào, mọi nghi ngờ đã được đoạn trừ ngay tại Bồ Đề Đạo Tràng; vì vậy cũng không có câu hỏi đoạn trừ nghi hoặc. Tuy nhiên, hai loại câu hỏi còn lại có ở chư Phật. Trong đó, đây là câu hỏi với mong muốn được nói.
Iti imāsu pañcasu pucchāsu adiṭṭhassa tāva kassaci dhammassa abhāvato tathāgatassa adiṭṭhajotanā pucchā natthi. ‘‘Idaṃ nāma aññehi paṇḍitehi samaṇabrāhmaṇehi saddhiṃ saṃsanditvā desessāmī’’ti samannāhārasseva anuppajjanato diṭṭhasaṃsandanā pucchāpi natthi. Yasmā pana buddhānaṃ ekadhammepi āsappanā parisappanā natthi, bodhimaṇḍeyeva sabbā kaṅkhā chinnā; tasmā vimaticchedanā pucchāpi natthiyeva. Avasesā pana dve pucchā buddhānaṃ atthi, tāsu ayaṃ kathetukamyatā pucchā nāma.
8. Now to explain the meaning of what was asked through this question wishing to explain, he said "having abandoned the killing of living beings" and so forth.
8. Bây giờ, để trả lời câu hỏi với mong muốn được nói ấy, Ngài nói "từ bỏ sát sanh", v.v...
8. Idāni taṃ kathetukamyatāya pucchāya pucchitamatthaṃ kathetuṃ ‘‘pāṇātipātaṃ pahāyā’’tiādimāha.
There, "killing of living beings" means the destruction of life, the slaughter of beings, the taking of life. Here, "being" conventionally means a creature, but ultimately means the life faculty. The intention to kill that arises through either bodily or verbal action, aimed at cutting off the life faculty of what one perceives as a being, is killing living beings. When done to beings lacking special qualities like animals, it is less blameworthy with small creatures and more blameworthy with large ones, due to the greater effort required. Even with equal effort, it varies with the size of the object. With beings possessing qualities like humans, it is less blameworthy with those of few qualities and more blameworthy with those of many qualities. When body and qualities are equal, it should be understood as less blameworthy when defilements and effort are mild, more blameworthy when they are strong.
Ở đây, "sát sanh" (pāṇātipāto) là sự giết hại sinh mạng, sự giết hại, sự sát hại. Ở đây, "sinh mạng" (pāṇa) theo cách nói thông thường là chúng sinh, theo nghĩa chân đế là mạng căn. Về chúng sanh đó, ý định giết hại khởi lên do sự tác động bởi sự nhận biết có chúng sanh, sự cắt đứt mạng căn, thông qua thân hoặc khẩu, ý định sát hại ấy là sát sanh. Việc đó, đối với những chúng sanh hạ liệt như súc sanh, v.v..., những chúng sanh nhỏ bé thì ít tội lỗi, những chúng sanh có thân thể lớn thì nhiều tội lỗi, vì sao? Vì sự nỗ lực lớn lao hơn. Khi sự nỗ lực ngang nhau, thì do tính chất lớn lao của đối tượng. Đối với những chúng sanh có đức hạnh như loài người, v.v..., những chúng sanh ít đức hạnh thì ít tội lỗi, những chúng sanh có đức hạnh lớn thì nhiều tội lỗi. Khi thân thể và đức hạnh ngang nhau, thì do sự yếu ớt của phiền não và sự nỗ lực thì ít tội lỗi, do sự mãnh liệt thì nhiều tội lỗi, nên hiểu như vậy.
Tattha pāṇassa atipāto pāṇātipāto, pāṇavadho, pāṇaghātoti vuttaṃ hoti. Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ, tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto. So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo, kasmā? Payogamahantatāya. Payogasamattepi vatthumahantatāya. Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo. Sarīraguṇānaṃ pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
It has five components: a living being, the perception of a living being, the intention to kill, the effort, and death resulting from it. There are six methods: by one's own hand, by commanding, by throwing, by fixed devices, by magic, by psychic power. If this matter were explained in detail it would become extremely lengthy, so we do not elaborate on this or similar topics. Those interested should consult the Vinaya Commentary Samantapasadika.
Nó có năm yếu tố – có chúng sanh, có sự nhận biết có chúng sanh, có tâm giết hại, có sự nỗ lực, có sự chết do sự nỗ lực đó. Có sáu cách thực hiện – tự tay làm, sai bảo người khác làm, ném (vũ khí), đặt bẫy, dùng bùa chú, dùng thần thông. Tuy nhiên, nếu ở đây trình bày chi tiết điều này và những điều tương tự khác, thì sẽ quá rộng. Vì vậy, chúng ta không trình bày chi tiết. Những ai có nhu cầu, nên xem và lấy từ Chú Giải Luật Tạng Samantapāsādikā (Samantapāsādikā).
Tassa pañca sambhārā honti – pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti . Cha payogā – sāhatthiko, āṇattiko, nissaggiyo, thāvaro, vijjāmayo, iddhimayoti. Imasmiṃ panatthe vitthāriyamāne ativiya papañco hoti, tasmā taṃ na vitthārayāma, aññañca evarūpaṃ. Atthikehi pana samantapāsādikaṃ vinayaṭṭhakathaṃ oloketvā gahetabbaṃ.
"Having abandoned" means having given up this misconduct consisting of the intention to kill living beings. "Abstains" means that from the time of abandoning, he remains abstaining from that misconduct. The meaning in similar passages should be understood in the same way as "there are no sense objects cognizable by eye or ear that he would transgress, much less physical actions."
"Từ bỏ" (Pahāya) nghĩa là từ bỏ ác hạnh, là ý định sát sanh này. "Hoàn toàn tránh xa" (Paṭivirato) nghĩa là sau khi đã từ bỏ, vị ấy hoàn toàn tránh xa ác hạnh đó. "Vị ấy không có ý nghĩ 'ta sẽ phạm vào', ngay cả những pháp được nhận biết qua mắt và tai, huống chi là qua thân." Ý nghĩa của những chỗ tương tự khác cũng nên được hiểu theo cách này.
Pahāyāti imaṃ pāṇātipātacetanāsaṅkhātaṃ dussīlyaṃ pajahitvā. Paṭiviratoti pahīnakālato paṭṭhāya tato dussīlyato orato viratova. Natthi tassa vītikkamissāmīti cakkhusotaviññeyyā dhammā pageva kāyikāti imināva nayena aññesupi evarūpesu padesu attho veditabbo.
"Ascetic" refers to the Blessed One who is known as one who has calmed evil. "Gotama" refers to his clan name. And not only the Blessed One but also the community of monks abstains from killing living beings. Though the teaching comes down from the beginning this way, when explaining the meaning it is proper to explain it with reference to the community of monks as well.
"Sa-môn" (Samaṇa) là Đức Thế Tôn, được gọi như vậy vì đã làm an tịnh các ác pháp. "Gotama" (Gotama) là theo dòng họ. Không chỉ Đức Thế Tôn hoàn toàn tránh xa sát sanh, mà Tăng chúng Tỳ kheo cũng hoàn toàn tránh xa, nhưng bài pháp đã được trình bày như vậy từ đầu. Tuy nhiên, khi làm sáng tỏ ý nghĩa, cũng nên làm sáng tỏ theo phương diện Tăng chúng.
Samaṇoti bhagavā samitapāpatāya laddhavohāro. Gotamoti gottavasena. Na kevalañca bhagavāyeva pāṇātipātā paṭivirato, bhikkhusaṅghopi paṭivirato, desanā pana ādito paṭṭhāya evaṃ āgatā, atthaṃ pana dīpentena bhikkhusaṅghavasenāpi dīpetuṃ vaṭṭati.
"With rod laid down, with sword laid down" means having put down rod and sword by not taking them up for harming others. Here, apart from rods, all other implements should be understood as "weapons" due to their potential to harm beings. When monks carry a walking stick, tooth-stick, razor or scissors, these are not for harming others. Therefore they still count as having laid down rod and weapon.
"Bỏ trượng, bỏ kiếm" (Nihitadaṇḍo nihitasatthoti) nghĩa là không cầm gậy hoặc kiếm để làm hại người khác, vị ấy là người đã bỏ gậy và bỏ kiếm. Ở đây, ngoại trừ gậy, tất cả những vật dụng còn lại có thể gây hại cho chúng sanh đều được xem là kiếm. Tuy nhiên, các Tỳ kheo cầm gậy chống, tăm xỉa răng, dao, lưỡi hái, những thứ này không phải để làm hại người khác. Vì vậy, vẫn được xem là đã bỏ trượng, bỏ kiếm.
Nihitadaṇḍo nihitasatthoti parūpaghātatthāya daṇḍaṃ vā satthaṃ vā ādāya avattanato nikkhittadaṇḍo ceva nikkhittasattho cāti attho. Ettha ca ṭhapetvā daṇḍaṃ sabbampi avasesaṃ upakaraṇaṃ sattānaṃ viheṭhanabhāvato satthanti veditabbaṃ. Yaṃ pana bhikkhū kattaradaṇḍaṃ vā dantakaṭṭhaṃ vā vāsiṃ pipphalikaṃ vā gahetvā vicaranti, na taṃ parūpaghātatthāya. Tasmā nihitadaṇḍo nihitasattho tveva saṅkhyaṃ gacchati.
"Scrupulous" means possessing conscience characterized by disgust for evil. "Sympathetic" means having developed sympathy and kindness. "Dwells showing compassion to all living beings" means being compassionate with thoughts of welfare toward all living beings. Due to that sympathy, he has thoughts of welfare for all living beings. "Dwells" means conducts himself, carries on, continues, maintains. "Thus indeed, monks" means "in this way, monks." The word "or" is used to show alternatives looking back to "having abandoned taking what is not given" and so forth. Throughout, it should be understood as showing alternatives looking either backward or forward.
"Có tàm quý" (Lajjī) nghĩa là có đầy đủ sự tàm quý, là sự ghê tởm tội lỗi. "Có lòng từ bi" (Dayāpanno) nghĩa là có lòng từ, có tâm từ. "Thương xót tất cả chúng sanh" (Sabbapāṇabhūtahitānukampī) nghĩa là thương xót tất cả chúng sanh bằng tâm từ. Do có lòng từ bi, nên vị ấy có tâm từ đối với tất cả chúng sanh, đó là ý nghĩa. "An trú" (Viharatī) nghĩa là đi, đứng, ngồi, nằm, sống, duy trì mạng sống . "Như vậy, này các Tỳ kheo" (Iti vā hi, bhikkhave). Chữ "hoặc" (vā) được dùng với nghĩa lựa chọn, liên quan đến những câu sau "từ bỏ lấy của không cho", v.v... Như vậy, ở mọi nơi nên hiểu về tính chất lựa chọn, liên quan đến câu trước hoặc câu sau.
Lajjīti pāpajigucchanalakkhaṇāya lajjāya samannāgato. Dayāpannoti dayaṃ mettacittataṃ āpanno. Sabbapāṇabhūtahitānukampīti; sabbe pāṇabhūte hitena anukampako. Tāya dayāpannatāya sabbesaṃ pāṇabhūtānaṃ hitacittakoti attho. Viharatīti iriyati yapeti yāpeti pāleti . Iti vā hi, bhikkhaveti evaṃ vā bhikkhave. Vā saddo upari ‘‘adinnādānaṃ pahāyā’’tiādīni apekkhitvā vikappattho vutto, evaṃ sabbattha purimaṃ vā pacchimaṃ vā apekkhitvā vikappabhāvo veditabbo.
This is the summary here: Monks, an ordinary person praising the Tathagata would say: "The ascetic Gotama does not kill or slaughter beings, nor approve of it, but abstains from this misconduct. Oh how great are the Buddha's qualities!" Thus even wanting to praise with great enthusiasm, they will only speak of limited, basic aspects of conduct and virtue. They cannot praise based on his unique higher qualities. And not only ordinary people, but stream-enterers, once-returners, non-returners, arahants and even private buddhas cannot do so. Only the Tathagata himself can - we will explain that later. This is the meaningful explanation with its purpose. From here on we will explain only new terms.
Ở đây, tóm lại là – Này các Tỳ kheo, phàm phu khi nói lời tán dương Như Lai, sẽ nói như vậy – "Sa-môn Gotama không giết hại sinh mạng, không sát hại, không tán thành việc đó, hoàn toàn tránh xa ác hạnh này; ồ, thật là đức hạnh của Phật lớn lao thay", như vậy, dù muốn nói lời tán dương, dù nỗ lực đến mức độ lớn, cũng chỉ nói về giới hạnh ít ỏi, nhỏ nhặt mà thôi. Vị ấy sẽ không thể nói lời tán dương dựa trên tính chất không chung (với phàm phu) ở phía trên. Không chỉ phàm phu, mà cả bậc Dự Lưu, Nhất Lai, Bất Lai, A-la-hán, Độc Giác Phật cũng không thể; chỉ có Như Lai mới có thể, ta sẽ nói cho các ông ở phía trên, đây là sự giải thích ý nghĩa có kèm theo ý chỉ ở đây. Từ đây về sau, ta sẽ chỉ giải thích những từ chưa được giải thích.
Ayaṃ panettha saṅkhepo – bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno evaṃ vadeyya – ‘‘samaṇo gotamo pāṇaṃ na hanati, na ghāteti, na tattha samanuñño hoti, virato imasmā dussīlyā; aho, vata re buddhaguṇā mahantā’’ti, iti mahantaṃ ussāhaṃ katvā vaṇṇaṃ vattukāmopi appamattakaṃ oramattakaṃ ācārasīlamattakameva vakkhati. Upari asādhāraṇabhāvaṃ nissāya vaṇṇaṃ vattuṃ na sakkhissati. Na kevalañca puthujjanova sotāpannasakadāgāmianāgāmiarahantopi paccekabuddhāpi na sakkontiyeva; tathāgatoyeva pana sakkoti, taṃ vo upari vakkhāmīti, ayamettha sādhippāyā atthavaṇṇanā. Ito paraṃ pana apubbapadameva vaṇṇayissāma.
In "having abandoned taking what is not given," taking what is not given means taking what belongs to others, theft, stealing. There, "what is not given" means what is possessed by others, where the owner can do as they wish without punishment or blame. The intention to steal that arises through undertaking to take what one perceives as belonging to others is taking what is not given. It is less blameworthy with inferior possessions of others and more blameworthy with superior ones. Why? Due to the superior nature of the object. When objects are equal, it is more blameworthy with possessions of those with superior qualities. In comparison with those of superior qualities, it is less blameworthy with possessions of those with inferior qualities.
Ở đây, "từ bỏ lấy của không cho" (Adinnādānaṃ pahāyāti), lấy của không cho là sự chiếm đoạt của người khác, trộm cắp, hành vi trộm cướp, đó là ý nghĩa. "Không cho" (Adinna) ở đây là vật thuộc sở hữu của người khác, mà khi người khác sử dụng theo ý muốn, không bị trừng phạt và không bị chê trách. Về vật thuộc sở hữu của người khác ấy, ý định trộm cắp khởi lên do sự tác động bởi sự nhận biết vật thuộc sở hữu của người khác, sự chiếm đoạt vật ấy, ý định trộm cắp ấy là lấy của không cho. Việc đó, đối với vật hạ liệt thuộc sở hữu của người khác thì ít tội lỗi, đối với vật quý giá thì nhiều tội lỗi, vì sao? Vì tính chất quý giá của vật. Khi vật ngang nhau, thì đối với vật thuộc sở hữu của người có đức hạnh cao thì nhiều tội lỗi . Tùy theo đức hạnh cao của người đó, đối với vật thuộc sở hữu của người có đức hạnh thấp hơn thì ít tội lỗi.
Adinnādānaṃ pahāyāti ettha adinnassa ādānaṃ adinnādānaṃ, parasaṃharaṇaṃ, theyyaṃ, corikāti vuttaṃ hoti. Tattha adinnanti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti. Tasmiṃ parapariggahite parapariggahitasaññino, tadādāyakaupakkamasamuṭṭhāpikā theyyacetanā adinnādānaṃ. Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ, kasmā? Vatthupaṇītatāya. Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ . Taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
It has five components: something belonging to others, perception that it belongs to others, intention to steal, the effort, and taking it thereby. There are six methods starting with one's own hand. These operate through various types of theft as appropriate: theft by taking, theft by force, concealed theft, theft by planning, fraudulent theft. This is the summary. The details are given in the Samantapasadika.
Nó có năm yếu tố – vật thuộc sở hữu của người khác, có sự nhận biết vật thuộc sở hữu của người khác, có tâm trộm cắp, có sự nỗ lực, có sự chiếm đoạt do sự nỗ lực đó. Có sáu cách thực hiện – giống như tự tay làm, v.v... (đã nói ở trên). Những cách đó, tùy theo trường hợp, được thực hiện bằng cách trộm cắp, cướp đoạt, lén lút, lừa đảo, dùng thủ đoạn, đó là tóm tắt ở đây. Phần chi tiết được nói trong Samantapāsādikā (Samantapāsādikā).
Tassa pañca sambhārā honti – parapariggahitaṃ, parapariggahitasaññitā, theyyacittaṃ, upakkamo, tena haraṇanti. Cha payogā – sāhatthikādayova. Te ca kho yathānurūpaṃ theyyāvahāro, pasayhāvahāro, paṭicchannāvahāro, parikappāvahāro, kusāvahāroti imesaṃ avahārānaṃ vasena pavattā, ayamettha saṅkhepo. Vitthāro pana samantapāsādikāyaṃ vutto.
"Takes only what is given" means one who takes only what is given. "Expects only what is given" means one who expects only what is mentally given. "Steals" means a thief. "Not by stealing but by being free from theft." Being free from theft means being pure. "By oneself" means by one's own state. It means having made oneself pure and free from theft, one dwells thus. The rest should be connected as explained in the first training rule. And as here, so everywhere.
"Chỉ nhận vật được cho" (Dinnameva ādiyatī) nghĩa là người nhận vật được cho. "Chỉ mong vật được cho, ngay cả bằng ý" (Cittenapi dinnameva paṭikaṅkhatī) nghĩa là người chỉ mong vật được cho. "Trộm" (Thenetī) nghĩa là kẻ trộm. Không phải kẻ trộm (thena) mà là không phải kẻ trộm (athena). Vì không phải là kẻ trộm, nên trong sạch. "Bản thân" (Attanā) nghĩa là với bản thân. Vị ấy an trú, sau khi làm cho bản thân không phải là kẻ trộm, trong sạch, đó là ý nghĩa. Phần còn lại nên được kết hợp theo cách đã được nói ở giới điều thứ nhất. Như ở đây, ở mọi nơi cũng vậy.
Dinnameva ādiyatīti dinnādāyī. Cittenapi dinnameva paṭikaṅkhatīti dinnapāṭikaṅkhī. Thenetīti theno. Na thenena athenena. Athenattāyeva sucibhūtena. Attanāti attabhāvena. Athenaṃ sucibhūtaṃ attānaṃ katvā viharatīti vuttaṃ hoti. Sesaṃ paṭhamasikkhāpade vuttanayeneva yojetabbaṃ. Yathā ca idha, evaṃ sabbattha.
Abstinence from sexual misconduct means abstinence from ignoble behavior. One who practices the noble practice is called a ব্রহ্মচারী (brahmacārī). One who stays far from sexual misconduct is called one who practices distance. Sexual intercourse means the unrighteous dharmas, so-called because they are indulged in by those who are overwhelmed by lust, and because they are engaged in by similar beings. The ways of villagers means the behaviors of those who live in villages.
Không hành phạm hạnh nghĩa là không có hành vi cao thượng. Người thực hành Phạm hạnh (Phạm: cao thượng, hạnh: hành vi) gọi là Phạm hạnh (brahmacārī). Xa lánh (ārācārī) nghĩa là người sống cách xa với việc không hành phạm hạnh. Dâm dục (methuna) là những pháp bất thiện được gọi là dâm dục, vì chúng nên được thực hành bởi những người có trạng thái tương đồng do tham ái chi phối. Pháp của người thế tục (gāmadhamma) là pháp của những người sống ở thế gian.
Abrahmacariyanti aseṭṭhacariyaṃ. Brahmaṃ seṭṭhaṃ ācāraṃ caratīti brahmacārī. Ārācārīti abrahmacariyato dūracārī. Methunāti rāgapariyuṭṭhānavasena sadisattā methunakāti laddhavohārehi paṭisevitabbato methunāti saṅkhyaṃ gatā asaddhammā. Gāmadhammāti gāmavāsīnaṃ dhammā.
9. Herein, abandoning false speech: false means a verbal or physical action that intends to deceive and spoil something, or, with the intention of deceiving, a volition that causes physical and verbal actions that deceive another.
9. Từ bỏ nói dối, ở đây, nói dối (musā) là sự cố ý làm sai lệch sự thật, là sự vận dụng lời nói và hành động để phá hoại sự thật, hoặc là ý định làm sai lệch sự thật, là tư tưởng làm phát sinh hành động và lời nói dối trá để lừa gạt người khác.
9.Musāvādaṃ pahāyāti ettha musāti visaṃvādanapurekkhārassa atthabhañjanako vacīpayogo kāyapayogo, vā visaṃvādanādhippāyena panassa paravisaṃvādakakāyavacīpayogasamuṭṭhāpikā cetanā musāvādo.
Another method: ‘false’ means a non-existent, untrue thing. ‘Speech’ is making it known as if it were existent and true. From the point of view of its characteristic, false speech is the volition that causes a person, wishing to make another understand an untrue thing as true, to express it as such. According to the object whose purpose is destroyed, it is of little fault if the object is insignificant, and of great fault if it is significant.
Một cách giải thích khác, ‘musā’ là điều không thực, không chân thật. ‘Vādo’ là sự trình bày điều đó như là có thật, là chân thật. Tuy nhiên, theo định nghĩa, nói dối (musāvāda) là ý định làm cho người khác hiểu sai sự thật, là tư tưởng làm phát sinh sự trình bày sai sự thật. Nó làm tổn hại đến ý nghĩa nào, nếu ý nghĩa đó nhỏ thì tội lỗi ít, nếu ý nghĩa đó lớn thì tội lỗi lớn.
Aparo nayo, ‘musā’ti abhūtaṃ atacchaṃ vatthu. ‘Vādo’ti tassa bhūtato tacchato viññāpanaṃ. Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo. So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
Moreover, for householders, it is of little fault if it is said with the intention of not giving what one possesses, saying “It does not exist,” etc. It is of great fault if spoken to destroy the object when one is a witness. For the ordained, it is of little fault if, having obtained a little oil or ghee, one says in a jesting way: “Today, I think oil is flowing like a river in the village”. It is of great fault for those who speak saying “I have seen,” although they have not seen.
Hơn nữa, đối với người tại gia, nói dối vì không muốn cho tài sản của mình, bắt đầu bằng [lời nói] "không có", thì tội lỗi ít; nói dối với tư cách là nhân chứng để phá hoại sự thật thì tội lỗi lớn; đối với người xuất gia, có được một chút dầu hay bơ rồi nói đùa rằng: "Hôm nay, ta thấy dầu ở trong làng chảy như sông" theo cách nói để làm cho đầy đủ, thì tội lỗi ít; nhưng đối với những người nói dối rằng "ta thấy" dù không thấy, thì tội lỗi lớn.
Api ca gahaṭṭhānaṃ attano santakaṃ adātukāmatāya natthītiādinayappavatto appasāvajjo, sakkhinā hutvā atthabhañjanatthaṃ vutto mahāsāvajjo, pabbajitānaṃ appakampi telaṃ vā sappiṃ vā labhitvā hasādhippāyena – ‘‘ajja gāme telaṃ nadī maññe sandatī’’ti pūraṇakathānayena pavatto appasāvajjo, adiṭṭhaṃyeva pana diṭṭhantiādinā nayena vadantānaṃ mahāsāvajjo.
It has four components: an untrue thing, the intention to deceive, the effort based on that, and the other’s understanding of that matter. One action is one’s own doing. It should be seen as the act of deceiving another by body, by something connected to the body, or by speech. And if by that action the other understands that matter, at the moment of volition causing that action, one is bound by the action of false speech.
Nói dối có bốn yếu tố cấu thành: sự việc không thật, ý định lừa dối, nỗ lực tương ứng, và người khác hiểu được ý nghĩa đó. Có một loại nỗ lực là tự mình làm. Nó nên được hiểu là sự thực hiện hành động lừa gạt người khác bằng thân, bằng những gì liên quan đến thân, hoặc bằng lời nói. Nếu người khác hiểu được ý nghĩa đó bằng hành động ấy, thì ngay trong khoảnh khắc tư tưởng làm phát sinh hành động đó, người ấy bị ràng buộc bởi nghiệp nói dối.
Tassa cattāro sambhārā honti – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti. Eko payogo sāhatthikova. So kāyena vā kāyapaṭibaddhena vā vācāya vā paravisaṃvādanakiriyākaraṇena daṭṭhabbo. Tāya ce kiriyāya paro tamatthaṃ jānāti, ayaṃ kiriyasamuṭṭhāpikacetanākkhaṇeyeva musāvādakammunā bajjhati.
Just as one deceives another by body, by something connected to the body, and by speech, one also deceives by commanding “Tell him this”, by writing a letter and placing it in front of him, or by writing on walls etc. “This matter should be seen thus”, and leaving it. Therefore, in this context, the actions of commanding, leaving, etc. are also suitable; as they are not explained in the commentaries, they are to be understood after careful consideration.
Hơn nữa, như người ta lừa gạt người khác bằng thân, những gì liên quan đến thân, và lời nói, cũng như vậy khi ra lệnh "hãy nói điều này cho người ấy", viết vào thư rồi ném trước mặt, viết vào vách tường và đặt ở đó rằng "ý nghĩa này nên được hiểu như thế này". Vì vậy, ở đây, các loại nỗ lực như sai bảo, vứt bỏ, và giữ lại đều thích hợp, nhưng vì không được đề cập trong các Chú giải nên cần phải xem xét và chấp nhận.
Yasmā pana yathā kāyakāyapaṭibaddhavācāhi paraṃ visaṃvādeti, tathā ‘‘idamassa bhaṇāhī’’ti āṇāpentopi paṇṇaṃ likhitvā purato nissajjantopi, ‘‘ayamattho evaṃ daṭṭhabbo’’ti kuḍḍādīsu likhitvā ṭhapentopi. Tasmā ettha āṇattikanissaggiyathāvarāpi payogā yujjanti, aṭṭhakathāsu pana anāgatattā vīmaṃsitvā gahetabbā.
One speaks truth means a truthful speaker. One connects truth with truth means one who joins truth. That is, one does not speak falsely in between. For a person who sometimes speaks falsely, and sometimes speaks truly, his truth is not joined with truth because it is interrupted by false speech; therefore, he is not one who joins truth. But this one is not like that, he does not speak falsely even for the sake of his life, he joins truth with truth, therefore he is one who joins truth.
Nói sự thật nghĩa là người nói sự thật (saccavādī). Gắn kết sự thật bằng sự thật nghĩa là người chân thật (saccasandho). Nghĩa là không nói dối xen kẽ. Vì người nào đôi khi nói dối, đôi khi nói thật, sự thật của người đó không được gắn kết với sự thật, vì bị gián đoạn bởi lời nói dối; do đó, người đó không phải là người chân thật. Nhưng người này thì không như vậy, dù vì mạng sống cũng không nói dối, mà gắn kết sự thật với sự thật, nên là người chân thật.
Saccaṃ vadatīti saccavādī. Saccena saccaṃ sandahati ghaṭetīti saccasandho. Na antarantarā musā vadatīti attho. Yo hi puriso kadāci musā vadati, kadāci saccaṃ, tassa musāvādena antaritattā saccaṃ saccena na ghaṭīyati; tasmā so na saccasandho. Ayaṃ pana na tādiso, jīvitahetupi musā avatvā saccena saccaṃ sandahati yevāti saccasandho.
Firm means steady, one of steady speech. For one person is not of steady speech like a turmeric dye, like a post embedded in a heap of chaff, or like a round pot placed on a donkey’s back. One is of steady speech like an inscription on stone or like Indra’s post, he does not speak two words even when his head is being cut off with a sword, this one is called firm.
Vững chắc (theto) nghĩa là vững vàng, lời nói vững vàng. Có người không có lời nói vững vàng, giống như vải nhuộm nghệ, như cọc đóng trên đống trấu, hay như ghè nước đặt trên lưng lừa; có người có lời nói vững vàng, như chữ khắc trên đá, như cột trụ của cổng thành, dù bị chém đầu bằng kiếm cũng không nói hai lời, người này được gọi là vững chắc.
Thetoti thiro thirakathoti attho. Eko hi puggalo haliddirāgo viya, thusarāsimhi nikhātakhāṇu viya, assapiṭṭhe ṭhapitakumbhaṇḍamiva ca na thirakatho hoti, eko pāsāṇalekhā viya, indakhīlo viya ca thirakatho hoti, asinā sīsaṃ chindantepi dve kathā na katheti, ayaṃ vuccati theto.
Trustworthy means one who should be trusted, one who should be believed in. For one person is not trustworthy, when it is said “By whom was this said, by so-and-so”, one comes to the point of having to say “Do not believe his words”. One is trustworthy, when it is said “By whom was this said, by so-and-so”, one comes to the point of having to say “If it was said by him, this is the authority, there is nothing to investigate now, it is just so”, this one is called trustworthy. He does not deceive the world means that by his truthful speech he does not deceive the world.
Đáng tin (paccayiko) nghĩa là người đáng được tin tưởng, đáng được tin cậy. Có người không đáng tin, khi được hỏi "điều này do ai nói, do người kia nói", thì đáng bị nói rằng "đừng tin lời của người đó". Có người đáng tin, khi được hỏi "điều này do ai nói, do người kia nói", thì đáng được nói rằng "nếu do người đó nói, thì chính điều này là đúng, bây giờ không cần phải xem xét, điều này là như vậy", người này được gọi là đáng tin. Không lừa dối thế gian nghĩa là không lừa dối thế gian bằng sự thật ấy.
Paccayikoti pattiyāyitabbako, saddhāyitabbakoti attho. Ekacco hi puggalo na paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘mā tassa vacanaṃ saddahathā’’ti vattabbataṃ āpajjati. Eko paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘yadi tena vuttaṃ, idameva pamāṇaṃ, idāni upaparikkhitabbaṃ natthi, evameva ida’’nti vattabbataṃ āpajjati, ayaṃ vuccati paccayiko. Avisaṃvādako lokassāti tāya saccavāditāya lokaṃ na visaṃvādetīti attho.
Having abandoned divisive speech, etc.: that speech which creates affection for oneself in the heart of the one who speaks that speech, or whose speech he speaks, and creates emptiness for another, that is divisive speech.
Trong các câu từ bỏ lời nói đâm thọc, v.v..., lời nói nào làm cho người nói lời ấy cảm thấy mình được yêu mến trong lòng, và người khác trở nên trống rỗng, thì đó là lời nói đâm thọc (pisuṇā vācā).
Pisuṇaṃvācaṃ pahāyātiādīsu yāya vācāya yassa taṃ vācaṃ bhāsati, tassa hadaye attano piyabhāvaṃ, parassa ca suññabhāvaṃ karoti, sā pisuṇā vācā.
That speech which makes oneself and another harsh, or that speech which is itself harsh, not pleasant to the ear, not heartwarming, this is harsh speech.
Lời nói nào làm cho chính mình và người khác trở nên thô bạo, hoặc lời nói nào tự nó thô bạo, không êm tai, không thấm vào lòng, thì đó là lời nói thô ác (pharusā vācā).
Yāya pana attānampi parampi pharusaṃ karoti, yā vācā sayampi pharusā, neva kaṇṇasukhā na hadayaṅgamā, ayaṃ pharusā vācā.
One who babbles pointlessly is one who chatters idly.
Người nào nói lời vô ích (samphaṃ), thì đó là lời nói nhảm nhí (samphappalāpo).
Yena samphaṃ palapati niratthakaṃ, so samphappalāpo.
The volition that is the root of these also gets the name of divisive speech, etc., and that is what is intended here.
Tư tưởng, là nguồn gốc của chúng, cũng được gọi là lời nói đâm thọc, v.v..., và chính tư tưởng ấy được xem là chủ yếu ở đây.
Tesaṃ mūlabhūtā cetanāpi pisuṇavācādināmeva labhati, sā eva ca idhādhippetāti.
Therein, the volition causing physical and verbal actions, with a defiled mind, for the purpose of causing division among others, or for one’s own affection, is divisive speech. It is of little fault if the person one causes to be divided has little virtue, and of great fault if he has great virtue.
Trong đó, tư tưởng làm phát sinh hành động và lời nói, với tâm bị ô nhiễm, để chia rẽ người khác hoặc vì muốn được yêu mến, là lời nói đâm thọc. Nó làm chia rẽ người nào, nếu người đó ít đức hạnh thì tội lỗi ít, nếu người đó nhiều đức hạnh thì tội lỗi lớn.
Tattha saṃkiliṭṭhacittassa paresaṃ vā bhedāya attano piyakamyatāya vā kāyavacīpayogasamuṭṭhāpikā cetanā pisuṇavācā. Sā yassa bhedaṃ karoti, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It has four components: another to be divided, the intention to cause division, thinking “Thus, they will become different, they will be separated”, or the desire for affection, thinking “Thus, I will become dear, trustworthy”, the effort based on that, and his understanding of that matter. Having heard in the presence of these who are described as such, “these”, for the sake of dividing them.
Lời nói đâm thọc có bốn yếu tố cấu thành: người bị chia rẽ, ý định chia rẽ rằng "như vậy những người này sẽ khác biệt, sẽ không còn ở cùng nhau", hoặc ý định muốn được yêu mến rằng "như vậy ta sẽ được yêu mến, được tin tưởng", nỗ lực tương ứng, và người đó hiểu được ý nghĩa đó. Để chia rẽ những người này nghĩa là để chia rẽ những người đã nghe thấy điều gì đó từ những người được nói đến ở trước đó.
Tassā cattāro sambhārā – bhinditabbo paro, ‘‘iti ime nānā bhavissanti, vinā bhavissantī’’ti bhedapurekkhāratā vā, ‘‘iti ahaṃ piyo bhavissāmi vissāsiko’’ti piyakamyatā vā, tajjo vāyāmo, tassa tadatthavijānananti. Imesaṃ bhedāyāti, yesaṃ itoti vuttānaṃ santike sutaṃ tesaṃ bhedāya.
Or a uniter of those who are divided means that he approaches each one of two friends or those who share the same preceptor, etc., who have been divided for some reason, and saying “For those born in such a clan as yours, so learned, this is not suitable”, etc., he acts as a reconciler, and supports reconciliation. Giving encouragement means one who gives encouragement to reconciliation. Seeing two people harmonious – “For those born in such a clan as yours, endowed with such virtues, this is not fitting”, etc., speaking thus, he performs a strengthening. He whose pleasure is in harmony is one whose pleasure is in harmony. He does not even wish to dwell where there are no harmonious ones. The reading “one who delights in harmony” is also found, this is the meaning here. One who is delighted in harmony means one who is delighted in harmonious ones, he does not even wish to go elsewhere leaving them. He rejoices having seen or heard of harmony means one who rejoices in harmony, he speaks speech that creates harmony means the speech which makes beings harmonious, he speaks speech that is indicative of the virtue of concord, not otherwise.
Hàn gắn những người đã chia rẽ nghĩa là hàn gắn, cố gắng hàn gắn hai người bạn hoặc những người đồng tu, v.v..., đã chia rẽ vì một lý do nào đó, bằng cách đến gặp từng người và nói: "Đối với những người sinh ra trong gia đình như các vị, có học thức rộng như vậy, thì điều này không phù hợp", v.v... Người không tạo ra sự hàn gắn nghĩa là người không tạo ra sự hàn gắn. Thấy hai người hòa hợp, liền nói: "Đối với những người sinh ra trong gia đình như các vị, có đầy đủ các đức hạnh như vậy, thì điều này không xứng đáng", v.v... để làm cho sự việc trở nên vững chắc hơn. Vui thích trong sự hòa hợp (samaggārāmo) nghĩa là người ấy. Người ấy không muốn ở nơi không có sự hòa hợp. Cũng có bản kinh là “samaggarāmopi”, ý nghĩa ở đây là như vậy. Người vui vẻ trong sự hòa hợp (samaggarato) nghĩa là vui vẻ trong những người hòa hợp, không muốn rời bỏ họ để đi đến nơi khác. Người hoan hỷ khi thấy và nghe sự hòa hợp (samagganandī), người nói lời tạo nên sự hòa hợp (samaggakaraṇiṃ vācaṃ bhāsati) nghĩa là người nói lời lẽ làm cho chúng sinh hòa hợp, lời nói làm hiển lộ những đức tính của sự hòa hợp, chứ không phải lời nói khác.
Bhinnānaṃ vā sandhātāti dvinnaṃ mittānaṃ vā samānupajjhāyakādīnaṃ vā kenacideva kāraṇena bhinnānaṃ ekamekaṃ upasaṅkamitvā ‘‘tumhākaṃ īdise kule jātānaṃ evaṃ bahussutānaṃ idaṃ na yutta’’ntiādīni vatvā sandhānaṃ kattā anukattā. Anuppadātāti sandhānānuppadātā. Dve jane samagge disvā – ‘‘tumhākaṃ evarūpe kule jātānaṃ evarūpehi guṇehi samannāgatānaṃ anucchavikameta’’ntiādīni vatvā daḷhīkammaṃ kattāti attho. Samaggo ārāmo assāti samaggārāmo. Yattha samaggā natthi, tattha vasitumpi na icchatīti attho. Samaggarāmotipi pāḷi, ayamevettha attho. Samaggaratoti samaggesu rato, te pahāya aññattha gantumpi na icchatīti attho. Samagge disvāpi sutvāpi nandatīti samagganandī,samaggakaraṇiṃ vācaṃ bhāsitāti yā vācā satte samaggeyeva karoti , taṃ sāmaggiguṇaparidīpikameva vācaṃ bhāsati, na itaranti.
The utterly harsh volition causing physical and verbal actions that pierces another’s vital points is harsh speech. For the purpose of making it clear, this is the story: a certain boy, not heeding his mother’s words, goes to the forest. His mother, unable to stop him, cursed: “May a fierce she-buffalo chase you.” Then, in the forest, a she-buffalo arose just as she had said. The boy made an act of truth: “May what my mother said with her mouth not happen, may what she thought in her mind happen.” The she-buffalo stood there as if bound. In this way, even an action that pierces the vital points is not harsh speech because of the gentleness of the mind. For sometimes parents say this to their children: “May thieves cut you into pieces,” but they do not wish even a lotus petal to fall on them. And sometimes preceptors and teachers say this to those under their care: “Why do these shameless and reckless ones wander, expel them,” but they desire their attainment of the paths and fruitions. And just as it is not harsh speech because of the gentleness of the mind, so it is not non-harsh speech because of the gentleness of the speech. For the words of one who wishes to kill: “Make him sleep comfortably,” are not non-harsh speech, because of the harshness of the mind, it is harsh speech. It is of little fault according to the person with regard to whom it is instigated, if he has little virtue, and of great fault if he has great virtue. It has three components: another to be abused, an angry mind, and the act of abusing.
Tư tưởng thô ác hoàn toàn, làm phát sinh hành động và lời nói cắt đứt phần cốt tủy của người khác, là lời nói thô ác (pharusāvācā). Để làm rõ điều này, có câu chuyện như sau: một đứa trẻ không nghe lời mẹ, đi vào rừng, người mẹ không thể ngăn cản được, liền nguyền rủa: "Con trâu hung dữ hãy đuổi theo mày". Rồi ở trong rừng, một con trâu liền xuất hiện. Đứa trẻ liền làm một lời nói chân thật rằng: "Những gì mẹ ta nói bằng miệng, xin đừng xảy ra, những gì mẹ ta nghĩ trong lòng, xin hãy xảy ra". Con trâu liền đứng yên như bị trói. Như vậy, ngay cả nỗ lực cắt đứt phần cốt tủy, do sự mềm mại của tâm, cũng không phải là lời nói thô ác. Vì cha mẹ đôi khi nói với con cái như thế này: "Mong cho bọn trộm cướp chặt các con ra từng mảnh", nhưng họ không muốn một cánh hoa sen rơi trên người chúng. Các bậc thầy và các vị hướng dẫn đôi khi nói với những người đệ tử như thế này: "Tại sao những kẻ vô liêm sỉ, không biết hổ thẹn này lại đi lại như vậy, hãy đuổi chúng đi", nhưng họ mong muốn chúng đạt được sự thành tựu trong việc học tập và chứng ngộ. Như do sự mềm mại của tâm mà không phải là lời nói thô ác, cũng như vậy do sự mềm mại của lời nói mà không phải là lời nói không thô ác. Vì lời nói của người muốn giết người rằng: "Hãy cho người này ngủ ngon" không phải là lời nói không thô ác, mà do sự thô ác của tâm nên nó là lời nói thô ác. Nó xảy ra đối với người nào, nếu người đó ít đức hạnh thì tội lỗi ít, nếu người đó nhiều đức hạnh thì tội lỗi lớn. Nó có ba yếu tố cấu thành: người bị mắng chửi, tâm sân hận, và sự mắng chửi.
Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusacetanā pharusāvācā. Tassā āvibhāvatthamidaṃ vatthu – eko kira dārako mātuvacanaṃ anādiyitvā araññaṃ gacchati, taṃ mātā nivattetumasakkontī – ‘‘caṇḍā taṃ mahiṃsī anubandhatū’’ti akkosi. Athassa tatheva araññe mahiṃsī uṭṭhāsi. Dārako ‘‘yaṃ mama mātā mukhena kathesi, taṃ mā hotu, yaṃ cittena cintesi taṃ hotū’’ti, saccakiriyamakāsi. Mahiṃsī tattheva baddhā viya aṭṭhāsi. Evaṃ mammacchedakopi payogo cittasaṇhatāya na pharusā vācā hoti. Mātāpitaro hi kadāci puttake evaṃ vadanti – ‘‘corā vo khaṇḍākhaṇḍaṃ karontū’’ti, uppalapattampi ca nesaṃ upari patantaṃ na icchanti. Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti – ‘‘kiṃ ime ahirīkā anottappino caranti, niddhamatha ne’’ti, atha ca nesaṃ āgamādhigamasampattiṃ icchanti. Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācā na hoti. Na hi mārāpetukāmassa – ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusā vācā hoti, cittapharusatāya panesā pharusā vācāva. Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā. Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.
Blameless, fault is called defect, that which does not have this fault is called blameless, meaning faultless. Like the blameless one mentioned in the “The one who is blameless and white-clad”,(Ud. 65). Pleasant to the ear means pleasant to the ears because of the sweetness of the expression, it does not cause ear-pain like the piercing of a needle. It creates affection without creating anger in the whole body because of the sweetness of the meaning, it is to be loved. It goes to the heart, it enters the mind pleasantly without being rejected, thus it is heart-warming. Because it is full of virtue, it is refined, it is also refined like a woman raised in the city. It is also refined as it belongs to the city. It means the speech of city-dwellers. For city-dwellers are ones of proper speech. They call ‘measure of affection’ as affection, ‘measure of brotherhood’ as brotherhood, and ‘measure of motherhood’ as motherhood. Such speech is desired by many people means it is desired by many people. By the very fact of being desired, it is pleasing to many people, it increases the mind means it is pleasing to many people.
Không lỗi lầm (nelā) nghĩa là lỗi lầm (elaṃ) được gọi là দোষ, không có lỗi lầm đó (nāssā elanti) nghĩa là không có lỗi. Giống như “nelaṃ” được nói trong câu "Nelaṅgo setapacchādo" (vị ấy không lỗi lầm, che phủ bằng màu trắng) (Ud. 65). Êm tai (kaṇṇasukhā) nghĩa là êm dịu đối với tai do sự ngọt ngào của âm thanh, không gây ra đau nhức tai như kim châm. Đáng yêu (pemanīyā) nghĩa là làm phát sinh tình yêu thương, không làm phát sinh sự giận dữ trong toàn thân do sự ngọt ngào của ý nghĩa. Thấm vào lòng (hadayaṅgamā) nghĩa là đi vào trái tim, đi vào tâm một cách dễ dàng, không bị ngăn cản. Thuộc về thành thị (porī) nghĩa là đầy đủ các phẩm chất, dịu dàng như người phụ nữ trưởng thành ở trong thành phố cũng là porī. Cũng có nghĩa là thuộc về thành phố (purassa esātipi porī). Lời nói của người dân thành phố. Vì người dân thành phố có lời nói khéo léo. Người ta nói rằng: "mức độ của cha là cha, mức độ của anh là anh, mức độ của mẹ là mẹ". Lời nói như vậy được nhiều người ưa thích (bahujanakantā). Do tính chất được ưa thích nên làm cho tâm của nhiều người hoan hỷ (bahujanamanāpā).
Nelāti elaṃ vuccati doso, nāssā elanti nelā, niddosāti attho. ‘‘Nelaṅgo setapacchādo’’ti, (udā. 65) ettha vuttanelaṃ viya. Kaṇṇasukhāti byañjanamadhuratāya kaṇṇānaṃ sukhā, sūcivijjhanaṃ viya kaṇṇasūlaṃ na janeti. Atthamadhuratāya sakalasarīre kopaṃ ajanetvā pemaṃ janetīti pemanīyā. Hadayaṃ gacchati, appaṭihaññamānā sukhena cittaṃ pavisatīti hadayaṅgamā. Guṇaparipuṇṇatāya pure bhavāti porī pure saṃvaḍḍhanārī viya sukumārātipi porī. Purassa esātipi porī. Nagaravāsīnaṃ kathāti attho. Nagaravāsino hi yuttakathā honti. Pitimattaṃ pitāti vadanti, bhātimattaṃ bhātāti vadanti, mātimattaṃ mātāti vadanti. Evarūpī kathā bahuno janassa kantā hotīti bahujanakantā. Kantabhāveneva bahuno janassa manāpā cittavuḍḍhikarāti bahujanamanāpā.
The unwholesome volition causing physical and verbal actions that indicate what is unbeneficial is idle chatter. It is of little fault because of the weakness of indulging in it, it is of great fault because of the greatness of indulging in it, it has two components: the intention to speak of unbeneficial matters such as the war of the Bharatas, the abduction of Sita, etc., and the speaking of such a story.
Tư tưởng bất thiện làm phát sinh hành động và lời nói trình bày điều vô ích là lời nói nhảm nhí (samphappalāpo). Do sự thực hành yếu ớt nên tội lỗi ít, do sự thực hành mạnh mẽ nên tội lỗi lớn, nó có hai yếu tố cấu thành: sự chú trọng vào những câu chuyện vô ích như chiến tranh của Bharata, sự bắt cóc Sita, v.v..., và sự kể những câu chuyện như vậy.
Anatthaviññāpikā kāyavacīpayogasamuṭṭhāpikā akusalacetanā samphappalāpo. So āsevanamandatāya appasāvajjo, āsevanamahantatāya mahāsāvajjo, tassa dve sambhārā – bhāratayuddhasītāharaṇādiniratthakakathāpurekkhāratā, tathārūpī kathā kathanañca.
He who speaks according to the right time is called a timely speaker; the meaning is that he speaks having discerned the appropriate time to speak. He who speaks of what is real, true, and factual is called a speaker of reality. He who speaks having established in mind the benefits related to the visible realm and the realm beyond is called a speaker of benefit. He who speaks having established in mind the non-world-transcending Dhamma is called a speaker of Dhamma, who speaks having established in mind restraint, discipline, abandoning, and discipline is a speaker of discipline.
Thời nói là người nói đúng thời, nghĩa là nhận biết thời điểm thích hợp để nói. Nói chân thật là nói những gì thực, sự thật, đúng với bản chất. Nói அர்த்தம் (có nghĩa) là nói dựa trên ý nghĩa của Pháp thế gian và Pháp xuất thế gian. Nói Pháp là nói dựa trên chín Pháp Siêu Thế. Nói Luật là nói dựa trên sự thúc liễm, chế ngự và đoạn trừ.
Kālena vadatīti kālavādī vattabbayuttakālaṃ sallakkhetvā vadatīti attho. Bhūtaṃ tathaṃ tacchaṃ sabhāvameva vadatīti bhūtavādī. Diṭṭhadhammikasamparāyikatthasannissitameva katvā vadatīti atthavādī. Navalokuttaradhammasannissitaṃ katvā vadatīti dhammavādī saṃvaravinayapahānavinayasannissitaṃ katvā vadatīti vinayavādī.
Treasury is said to be the place of depositing; he who possesses this treasury is called possessor of a treasury. The meaning is that he utters speech worthy of being treasured in the heart. Even while speaking in this way, he does not speak untimely, thinking, "I will speak speech that is a treasure," but rather he speaks having waited for the appropriate time. It is said that *sāpadesa* means with similes, with reasons. It is said that *pariyantavati* means having shown limitation, that he speaks in such a way that its limits are known. *Atthasaṃhita* means that he speaks in a way that is endowed with meaning, in that it is impossible to exhaust it even when splitting with various methods. Or, that he speaks speech connected with meaning because it is connected with the meaning that the speaker of benefit speaks; it is said that he does not speak one thing after setting aside another.
Nơi chốn (nidhāna) được gọi là chỗ an trí, có chỗ an trí ấy gọi là có chỗ an trí (nidhānavatī). Nghĩa là nói lời đáng được ghi nhớ trong tâm. Nói đúng thời nghĩa là dù nói như vậy – "Ta sẽ nói lời đáng ghi nhớ" nhưng không nói phi thời, mà chính là chờ đợi thời điểm thích hợp để nói. Có dẫn dụ (sāpadesa) nghĩa là có ví dụ, có nguyên nhân. Có giới hạn (pariyantavati) nghĩa là chỉ rõ sự giới hạn, như thế nào để nhận biết được sự giới hạn của nó, nói như vậy. Liên hệ đến nghĩa (atthasaṃhita) nghĩa là nói có ý nghĩa phong phú, vì cho dù có phân tích bằng nhiều cách cũng không thể thấu triệt hết. Hoặc là người nói nghĩa (atthavādī) nói điều có nghĩa (attha), vì liên hệ với điều có nghĩa (attha) ấy nên nói lời liên hệ đến nghĩa (atthasaṃhita), không phải nói điều này mà bỏ qua điều kia.
Nidhānaṃ vuccati ṭhapanokāso, nidhānamassā atthīti nidhānavatī. Hadaye nidhātabbayuttakaṃ vācaṃ bhāsitāti attho. Kālenāti evarūpiṃ bhāsamānopi ca – ‘‘ahaṃ nidhānavatiṃ vācaṃ bhāsissāmī’’ti na akālena bhāsati, yuttakālaṃ pana apekkhitvāva bhāsatīti attho. Sāpadesanti saupamaṃ, sakāraṇanti attho. Pariyantavatinti paricchedaṃ dassetvā yathāssā paricchedo paññāyati, evaṃ bhāsatīti attho. Atthasaṃhitanti anekehipi nayehi vibhajantena pariyādātuṃ asakkuṇeyyatāya atthasampannaṃ bhāsati. Yaṃ vā so atthavādī atthaṃ vadati, tena atthena sahitattā atthasaṃhitaṃ vācaṃ bhāsati, na aññaṃ nikkhipitvā aññaṃ bhāsatīti vuttaṃ hoti.
10. Regarding the cultivation of seeds and plants: seed of the root, seed of the stem, seed of the joint, seed of the shoot, and seed of the seed are the five kinds of seed-village, and there is the cultivation of any plant-village of blue grass, trees, and so on, that is, the meaning is abstaining from injuring them by cutting, splitting, cooking, and so on.
10. Sự hủy hoại hạt giống và cây cối (bījagāmabhūtagāmasamārambhā) nghĩa là sự hủy hoại đối với năm loại hạt giống là: hạt từ rễ, hạt từ thân, hạt từ đốt, hạt từ chồi, và hạt từ hạt, và đối với bất kỳ loại cây cỏ, cây cối nào, bằng cách cắt, chặt, nấu, v.v., nghĩa là tránh xa những việc này.
10.Bījagāmabhūtagāmasamārambhāti mūlabījaṃ khandhabījaṃ phaḷubījaṃ aggabījaṃ bījabījanti pañcavidhassa bījagāmassa ceva, yassa kassaci nīlatiṇarukkhādikassa bhūtagāmassa ca samārambhā, chedanabhedanapacanādibhāvena vikopanā paṭiviratoti attho.
*Ekabhattiko* means the morning meal and the evening meal are two meals, of these, the morning meal is limited to before midday, the other is from midday until the dawn. Therefore, even eating ten times within the midday, one is still only one who eats a single meal. It is in reference to this that it is said “*ekabhattiko*”.
Ăn ngày một bữa (ekabhattiko) nghĩa là có hai bữa ăn, bữa ăn sáng và bữa ăn chiều, trong đó, bữa ăn sáng được giới hạn trong khoảng thời gian trước giữa trưa, còn bữa kia là từ sau giữa trưa cho đến trước khi mặt trời lặn. Do đó, dù có ăn mười lần trong khoảng thời gian trước giữa trưa thì vẫn là người ăn ngày một bữa. Ý nói "người ăn ngày một bữa" là như vậy.
Ekabhattikoti pātarāsabhattaṃ sāyamāsabhattanti dve bhattāni, tesu pātarāsabhattaṃ antomajjhanhikena paricchinnaṃ, itaraṃ majjhanhikato uddhaṃ anto aruṇena. Tasmā antomajjhanhike dasakkhattuṃ bhuñjamānopi ekabhattikova hoti. Taṃ sandhāya vuttaṃ ‘‘ekabhattiko’’ti.
The meal at night is night, one who abstains from that is called abstaining at night. Eating from when midday has passed until the sun sets is called eating at the wrong time. Because of abstaining from that, it is “abstaining from eating at the wrong time.” When did he abstain? From the day of his going forth at the bank of the Anomā River.
Sự không ăn đêm (rattūparato), sự không ăn sau khi mặt trời đã qua giữa trưa cho đến khi lặn, gọi là ăn phi thời (vikālabhojana). Vì tránh xa điều đó, nên gọi là tránh ăn phi thời (virato vikālabhojanā). Khi nào thì tránh? Kể từ ngày xuất gia tại bờ sông Anomā.
Rattiyā bhojanaṃ ratti, tato uparatoti rattūparato. Atikkante majjhanhike yāva sūriyatthaṅgamanā bhojanaṃ vikālabhojanaṃ nāma. Tato viratattā virato vikālabhojanā. Kadā virato? Anomānadītīre pabbajitadivasato paṭṭhāya.
Because it is not in accordance with the Teaching, shows itself to be discordant and adversarial: seeing that is seeing discord. Because dancing, singing, and music, even if enacted by oneself through dancing and causing others to dance, and even if enacted through the dancing of peacocks, are seen as discordant, so “dancing, singing, music, seeing discord.” Indeed, neither for monks nor nuns is it proper to undertake dancing and the like themselves, or to cause others to undertake them, or to see them having been undertaken.
Xem múa hát (visūkadassana), vì không thích hợp với Giáo Pháp, là xem những thứ trái ngược. Tự mình nhảy múa hay sai người khác nhảy múa, v.v., và cả xem múa hát, v.v., dù cho là xem công múa, v.v., đi nữa, những thứ này đều là xem những thứ trái ngược (visūka), nên gọi là xem múa hát, nghe nhạc, xem diễn kịch (naccagītavāditavisūkadassanā). Vì Tỳ kheo hay Tỳ kheo ni đều không được phép tự mình thực hiện, sai người khác thực hiện, hoặc xem những thứ đã được thực hiện.
Sāsanassa ananulomattā visūkaṃ paṭāṇībhūtaṃ dassananti visūkadassanaṃ. Attanā naccananaccāpanādivasena naccā ca gītā ca vāditā ca antamaso mayūranaccādivasenapi pavattānaṃ naccādīnaṃ visūkabhūtā dassanā cāti naccagītavāditavisūkadassanā. Naccādīni hi attanā payojetuṃ vā parehi payojāpetuṃ vā payuttāni passituṃ vā neva bhikkhūnaṃ na bhikkhunīnañca vaṭṭanti.
Among garlands and the like, "garland" means any kind of flower. "Perfume" means any kind of scented substance. "Cosmetic" means that which colors the skin. Herein, wearing that is called supporting, adorning to fill up deficiencies is called decorating, delighting in the use of scents and coloring the skin is called beautifying. "Ground" means reason. Therefore, the meaning is that he abstains from the unwholesome intention through which ordinary people perform the wearing of garlands and the like.
Trong các thứ trang sức, hoa (mālā) là bất kỳ loại hoa nào. Hương (gandha) là bất kỳ loại hương liệu nào. Phấn sáp (vilepana) là thứ làm thay đổi màu da. Đeo vào (piḷandhanto) là mang, làm cho những chỗ còn thiếu trở nên đầy đủ là trang điểm, ưa thích vì mùi hương và vì sự thay đổi màu da là làm đẹp. Chỗ (ṭhāna) được gọi là nguyên nhân. Do đó, với ý định bất thiện nào mà người đời làm những việc như mang vòng hoa, v.v., thì tránh xa những việc đó.
Mālādīsu mālāti yaṃ kiñci pupphaṃ. Gandhanti yaṃ kiñci gandhajātaṃ. Vilepananti chavirāgakaraṇaṃ. Tattha piḷandhanto dhāreti nāma, ūnaṭṭhānaṃ pūrento maṇḍeti nāma, gandhavasena chavirāgavasena ca sādiyanto vibhūseti nāma. Ṭhānaṃ vuccati kāraṇaṃ. Tasmā yāya dussīlyacetanāya tāni mālādhāraṇādīni mahājano karoti, tato paṭiviratoti attho.
*Uccāsayanaṃ* means exceeding the standard. *Mahāsayanaṃ* means improper bedding. The meaning is that he abstains from that.
Giường cao (uccāsayana) là vượt quá tiêu chuẩn. Giường lớn (mahāsayana) là những thứ trải không thích hợp. Nghĩa là tránh xa những thứ ấy.
Uccāsayanaṃ vuccati pamāṇātikkantaṃ. Mahāsayananti akappiyapaccattharaṇaṃ. Tato viratoti attho.
*Jātarūpaṃ* means gold. *Rajataṃ* means a *kahāpaṇa*, a copper coin, a lac coin, or a wooden coin, whatever is used in commerce. It means that he abstains from accepting both of these, neither does he take them up, nor does he cause them to be taken up, nor does he enjoy what has been deposited.
Vàng (jātarūpa) là vàng ròng. Bạc (rajata) là tiền đồng, tiền sắt, tiền bằng nhựa cây, tiền bằng gỗ, là những thứ được lưu hành. Tránh xa việc nhận cả hai thứ này, nghĩa là không tự mình nhận, không sai người khác nhận, không ưa thích những thứ được dâng cúng.
Jātarūpanti suvaṇṇaṃ. Rajatanti kahāpaṇo, lohamāsako, jatumāsako, dārumāsakoti ye vohāraṃ gacchanti. Tassa ubhayassāpi paṭiggahaṇā paṭivirato, neva naṃ uggaṇhāti, na uggaṇhāpeti, na upanikkhittaṃ sādiyatīti attho.
*Āmakadhaññapaṭiggahaṇā* means abstaining from accepting any of the seven kinds of raw grain, namely rice, millet, barley, wheat, *kaṅgu*, *varaka*, and *kudrūsaka*. And not only is the accepting of these improper, but even consuming them raw is improper for monks. *Āmakamaṃsapaṭiggahaṇā* here, apart from specially permitted raw meat and fish, acceptance of those is not allowed for monks, let alone eating it raw.
Nhận thóc lúa sống (āmakadhaññapaṭiggahaṇā), nghĩa là nhận bảy loại thóc lúa sống, được gọi là lúa tẻ, lúa nếp, lúa mạch, lúa mì, kê, varaka, kudrūsaka. Không chỉ là nhận những thứ này, mà ngay cả việc ăn sống chúng cũng không được phép đối với các Tỳ kheo. Nhận thịt sống (āmakamaṃsapaṭiggahaṇā) nghĩa là, ngoại trừ thịt và cá sống đã được cho phép, việc nhận thịt và cá sống là không được phép đối với các Tỳ kheo, không phải là việc ăn sống.
Āmakadhaññapaṭiggahaṇāti, sālivīhiyavagodhūmakaṅguvarakakudrūsakasaṅkhātassa sattavidhassāpi āmakadhaññassa paṭiggahaṇā. Na kevalañca etesaṃ paṭiggahaṇameva, āmasanampi bhikkhūnaṃ na vaṭṭatiyeva. Āmakamaṃsapaṭiggahaṇāti ettha aññatra odissa anuññātā āmakamaṃsamacchānaṃ paṭiggahaṇameva bhikkhūnaṃ na vaṭṭati, no āmasanaṃ.
*Itthikumārikapaṭiggahaṇā* here *itthī* means one who has entered into a relationship with another man, the other is called *kumārikā*, acceptance of them, and even touching them is improper.
Nhận phụ nữ và trẻ em gái (itthikumārikapaṭiggahaṇā), ở đây, phụ nữ (itthī) là người đã thuộc về người đàn ông khác, còn lại được gọi là trẻ em gái (kumārikā), việc nhận hay chạm vào họ đều không thích hợp.
Itthikumārikapaṭiggahaṇāti ettha itthīti purisantaragatā, itarā kumārikā nāma, tāsaṃ paṭiggahaṇampi āmasanampi akappiyameva.
*Dāsidāsapaṭiggahaṇā* here, it is not allowable to accept them as a female slave or male slave. But it is allowable if one says: "I give a worker who makes things allowable," "I give a monastery attendant."
Nhận nô tỳ và nô lệ (dāsidāsapaṭiggahaṇā), ở đây, việc nhận họ làm nô tỳ và nô lệ là không được phép. Tuy nhiên, nếu nói "Tôi xin cho người làm việc, tôi xin cho người làm vườn," thì được phép.
Dāsidāsapaṭiggahaṇāti ettha dāsidāsavaseneva tesaṃ paṭiggahaṇaṃ na vaṭṭati. ‘‘Kappiyakārakaṃ dammi, ārāmikaṃ dammī’’ti evaṃ vutte pana vaṭṭati.
In the sections from animals to fields and building sites, the way of what is allowable and unallowable should be examined based on the Vinaya. Here, what is called a field is where early crops grow. What is called a building site is where late crops grow. Or the place where both grow is a field. The portion of unprepared land for that purpose is a building site. And through the topic of fields and building sites, even tanks for watering and the like are also included here.
Trong các thứ như dê, cừu, v.v., cho đến ruộng và đất, cần phải xem xét tính thích hợp và không thích hợp theo Luật. Ở đây, ruộng (khetta) là nơi trồng lúa tẻ. Đất (vatthu) là nơi trồng lúa nếp. Hoặc nơi trồng cả hai, đó là ruộng. Phần đất chưa được cày cấy vì mục đích đó là đất. Ở đây, ruộng và đất bao gồm cả ao, hồ, v.v., được đào.
Ajeḷakādīsu khettavatthupariyosānesu kappiyākappiyanayo vinayavasena upaparikkhitabbo. Tattha khettaṃ nāma yasmiṃ pubbaṇṇaṃ ruhati. Vatthu nāma yasmiṃ aparaṇṇaṃ ruhati. Yattha vā ubhayampi ruhati, taṃ khettaṃ. Tadatthāya akatabhūmibhāgo vatthu. Khettavatthusīsena cettha vāpitaḷākādīnipi saṅgahitāneva.
*Dūteyyaṃ* is said to be the work of a messenger, carrying letters or messages sent by householders and going here and there. *Pahiṇagamanaṃ* is said to be the minor travel of one who is sent from house to house. *Anuyogo* means the doing of both of these. Therefore, it means applying oneself to messenger duties and errands. Thus the meaning here should be understood.
Làm sứ giả (dūteyya) được gọi là công việc của người đưa tin, cầm thư từ hay thông điệp của người thế tục đi đến nơi này nơi kia. Đi thông báo (pahiṇagamana) được gọi là đi từ nhà này sang nhà khác theo sự sai bảo. Thực hiện (anuyoga) nghĩa là làm cả hai việc đó. Do đó, thực hiện việc làm sứ giả và đi thông báo (dūteyyapahiṇagamanānaṃ anuyogā). Cần phải hiểu nghĩa ở đây như vậy.
Dūteyyaṃ vuccati dūtakammaṃ, gihīnaṃ pahitaṃ paṇṇaṃ vā sāsanaṃ vā gahetvā tattha tattha gamanaṃ. Pahiṇagamanaṃ vuccati gharā gharaṃ pesitassa khuddakagamanaṃ. Anuyogo nāma tadubhayakaraṇaṃ. Tasmā dūteyyapahiṇagamanānaṃ anuyogāti. Evamettha attho veditabbo.
*Kayavikkayā* is buying and selling. Among cheating with the scale and the like, *kūṭa* means deception. Herein, *tulākūṭa* is fourfold: form-cheating, mark-cheating, grasping-cheating, and concealed-cheating. Herein, form-cheating means making two scales of similar appearance; taking, one takes with the large one, giving, one gives with the small one. Mark-cheating means, taking, one presses down on the scale with a hand on the back part, giving, on the front part. Grasping-cheating means, taking, one grasps the rope at the base, giving, at the tip. Concealed-cheating means making the scale hollow and placing iron filings inside; taking, one does it on the back part, giving, on the front part.
Mua và bán (kayavikkayā). Trong các thứ như cân lừa, v.v., lừa (kūṭa) nghĩa là lừa dối. Ở đây, cân lừa (tulākūṭa) nghĩa là có bốn loại: lừa về hình thức, lừa về bộ phận, lừa về cách cầm, và lừa che đậy. Trong đó, lừa về hình thức (rūpakūṭa) nghĩa là làm hai cái cân có hình thức giống nhau, khi cân để lấy thì dùng cái lớn, khi cân để cho thì dùng cái nhỏ. Lừa về bộ phận (aṅgakūṭa) nghĩa là khi cân để lấy thì dùng tay ấn vào phần sau của cân, khi cân để cho thì ấn vào phần trước. Lừa về cách cầm (gahaṇakūṭa) nghĩa là khi cân để lấy thì cầm vào phần gốc của dây, khi cân để cho thì cầm vào phần ngọn. Lừa che đậy (paṭicchannakūṭa) nghĩa là làm cho cái cân có lỗ hổng, bỏ bột sắt vào bên trong, khi cân để lấy thì làm cho nó ở phía sau, khi cân để cho thì làm cho nó ở phía trước.
Kayavikkayāti kayā ca vikkayā ca. Tulākūṭādīsu kūṭanti vañcanaṃ. Tattha tulākūṭaṃ nāma rūpakūṭaṃ aṅgakūṭaṃ, gahaṇakūṭaṃ, paṭicchannakūṭanti catubbidhaṃ hoti. Tattha rūpakūṭaṃ nāma dve tulā samarūpā katvā gaṇhanto mahatiyā gaṇhāti, dadanto khuddikāya deti. Aṅgakūṭaṃ nāma gaṇhanto pacchābhāge hatthena tulaṃ akkamati, dadanto pubbabhāge. Gahaṇakūṭaṃ nāma gaṇhanto mūle rajjuṃ gaṇhāti, dadanto agge. Paṭicchannakūṭaṃ nāma tulaṃ susiraṃ katvā anto ayacuṇṇaṃ pakkhipitvā gaṇhanto taṃ pacchābhāge karoti, dadanto aggabhāge.
*Kaṃso* is a gold bowl, deceiving with that is *kaṃsakūṭa*. How? Having made one gold bowl, one makes two or three other copper bowls of a golden color, then, going to a populated area and entering any middling household, says "Buy golden vessels." And when asked about the price, they are willing to give an equal price. Then when it is said by them, "How can their gold nature be known?" He says, "Examine them and take them," rubbing the golden bowl on a stone, gives all the bowls, and goes.
Đồng (kaṃso) nghĩa là bát bằng vàng, lừa dối bằng cái đó là lừa bằng đồng (kaṃsakūṭa). Như thế nào? Làm một cái bát bằng vàng, hai ba cái bát bằng sắt khác có màu vàng, rồi đi đến làng, vào một gia đình khá giả nào đó, nói – "Hãy mua đồ bằng vàng," khi được hỏi giá, họ muốn trả giá cao hơn. Rồi khi họ nói – "Làm thế nào để biết được những thứ này là vàng?" – "Hãy kiểm tra rồi lấy," đưa cái bát bằng vàng cho họ cọ xát vào đá, đưa tất cả các bát rồi đi.
Kaṃso vuccati suvaṇṇapāti, tāya vañcanaṃ kaṃsakūṭaṃ. Kathaṃ? Ekaṃ suvaṇṇapātiṃ katvā aññā dve tisso lohapātiyo suvaṇṇavaṇṇe karoti, tato janapadaṃ gantvā kiñcideva aḍḍhaṃ kulaṃ pavisitvā – ‘‘suvaṇṇabhājanāni kiṇathā’’ti vatvā agghe pucchite samagghataraṃ dātukāmā honti. Tato tehi – ‘‘kathaṃ imesaṃ suvaṇṇabhāvo jānitabbo’’ti vutte, ‘‘vīmaṃsitvā gaṇhathā’’ti suvaṇṇapātiṃ pāsāṇe ghaṃsitvā sabbā pātiyo datvā gacchati.
*Mānakūṭa* is threefold: heart-splitting, tip-splitting, and rope-splitting. Here, heart-splitting is obtained at the time of measuring ghee, oil, and the like. Indeed, taking these, one takes with a measure that is pierced below, saying, "Pour slowly," causing a great deal to spill into the inner vessel, and giving, covering the hole and filling it quickly, one gives.
Đo lường lừa (mānakūṭa) nghĩa là có ba loại: lừa về lõi, lừa về đỉnh, và lừa về dây. Trong đó, lừa về lõi (hadayabheda) có được khi đo những thứ như dầu mè. Vì khi đo để lấy, dùng cái ống đo có lỗ thủng ở dưới, nói – "Hãy rót từ từ," làm cho chảy tràn ra nhiều vào bên trong, khi đo để cho thì bịt lỗ lại, làm cho đầy nhanh chóng.
Mānakūṭaṃ nāma hadayabhedasikhābhedarajjubhedavasena tividhaṃ hoti. Tattha hadayabhedo sappitelādiminanakāle labbhati. Tāni hi gaṇhanto heṭṭhāchiddena mānena – ‘‘saṇikaṃ āsiñcā’’ti vatvā antobhājane bahuṃ paggharāpetvā gaṇhāti, dadanto chiddaṃ pidhāya sīghaṃ pūretvā deti.
Tip-splitting is obtained at the time of measuring sesame, rice, and the like. Indeed, taking these, raising the tip slowly, one takes, and giving, quickly filling it and breaking off the tip, one gives.
Lừa về đỉnh (sikhābheda) có được khi đo những thứ như mè, gạo. Vì khi đo để lấy, từ từ nâng cao đỉnh lên, khi đo để cho thì đổ đầy nhanh chóng, làm cho đỉnh bị cắt bớt.
Sikhābhedo tilataṇḍulādiminanakāle labbhati. Tāni hi gaṇhanto saṇikaṃ sikhaṃ ussāpetvā gaṇhāti, dadanto vegena pūretvā sikhaṃ chindanto deti.
Rope-splitting is obtained at the time of measuring fields and building sites. Indeed, not obtaining a bribe, they measure a field as large even though it is not large.
Lừa về dây (rajjubheda) có được khi đo ruộng và đất. Vì không tìm được lợi lộc, nên đo ruộng dù nhỏ cũng làm cho thành lớn.
Rajjubhedo khettavatthuminanakāle labbhati. Lañjaṃ alabhantā hi khettaṃ amahantampi mahantaṃ katvā minanti.
Among taking bribes and the like, taking bribes means taking a bribe to make an owner out of a non-owner. Deception means deceiving others by various means. And here is one story: a certain hunter was coming along, having caught a deer and a fawn. A certain crook said, "What, sir, does the deer cost, and what does the fawn cost?" And when it was said, "The deer costs two *kahāpaṇas*, and the fawn, one," giving one *kahāpaṇa*, he took the fawn, and going a little, returned, saying, "No, sir, I do not need the fawn, give me the deer." Thus it was said, "Give two *kahāpaṇas*." He said, "Was it not, sir, that one *kahāpaṇa* was given by me at first?" "Yes, it was given." "Take this fawn, and thus that *kahāpaṇa*, and this fawn worth a *kahāpaṇa*, will be two *kahāpaṇas*." He, thinking "He speaks reasonably," took the fawn and gave the deer. *Nikati* means deceit by way of misrepresentation or by magic, saying what is unpraiseworthy to be praiseworthy, what is not a gem to be a gem, what is not gold to be gold, cheating by means of counterfeiting. *Sāciyoga* is crooked practice, this is a name for just these taking bribes and the like. Therefore: taking bribes and crooked practice, deception and crooked practice, deceit and crooked practice, thus the meaning here should be seen. Some say that showing one thing and exchanging it for another is crooked practice. But that is included in deception itself.
Trong các thứ như hối lộ, v.v., hối lộ (ukkoṭana) nghĩa là nhận tiền hối lộ để làm cho người không phải là chủ trở thành chủ. Lừa dối (vañcana) nghĩa là lừa dối người khác bằng nhiều cách khác nhau. Đây là một câu chuyện – một người thợ săn nọ bắt được một con nai và một con nai con, một người xảo quyệt nói – "Này, con nai giá bao nhiêu, con nai con giá bao nhiêu?" Khi được trả lời – "Con nai giá hai đồng, con nai con giá một đồng," đưa một đồng, lấy con nai con, đi một đoạn, quay lại – "Này, tôi không cần con nai con, hãy đưa con nai cho tôi." Người kia nói – Vậy thì hãy đưa hai đồng. Anh ta nói – "Không phải ban đầu tôi đã đưa cho anh một đồng sao?" "Đúng, đã đưa." "Hãy lấy con nai con này, như vậy, một đồng kia, và con nai con đáng giá một đồng này là thành hai đồng." Người kia nghĩ – "Anh ta nói có lý," lấy con nai con, đưa con nai. Bất chính (nikati) nghĩa là bằng cách dùng mánh khóe hoặc ảo thuật, làm cho cái không đáng giá thành đáng giá, đá thường thành ngọc, không phải vàng thành vàng, lừa dối bằng thứ giả. Xảo trá (sāciyoga) là mánh khóe xảo quyệt, đây là tên gọi của những thứ như hối lộ, v.v. Do đó – hối lộ và xảo trá (ukkoṭanasāciyoga), lừa dối và xảo trá (vañcanasāciyoga), bất chính và xảo trá (nikatisāciyoga), cần phải hiểu nghĩa ở đây như vậy. Một số người nói rằng việc đưa cái này để đổi lấy cái khác là xảo trá (sāciyoga). Tuy nhiên, điều đó đã được bao gồm trong lừa dối (vañcana).
Ukkoṭanādīsu ukkoṭananti assāmike sāmike kātuṃ lañjaggahaṇaṃ. Vañcananti tehi tehi upāyehi paresaṃ vañcanaṃ. Tatridamekaṃ vatthu – eko kira luddako migañca migapotakañca gahetvā āgacchati , tameko dhutto – ‘‘kiṃ bho, migo agghati, kiṃ migapotako’’ti āha. ‘‘Migo dve kahāpaṇe, migapotako eka’’nti ca vutte ekaṃ kahāpaṇaṃ datvā migapotakaṃ gahetvā thokaṃ gantvā nivatto – ‘‘na me bho, migapotakena attho, migaṃ me dehī’’ti āha. Tena hi – dve kahāpaṇe dehīti. So āha – ‘‘nanu te bho, mayā paṭhamaṃ eko kahāpaṇo dinno’’ti? ‘‘Āma, dinno’’ti. ‘‘Idaṃ migapotakaṃ gaṇha, evaṃ so ca kahāpaṇo, ayañca kahāpaṇagghanako migapotakoti dve kahāpaṇā bhavissantī’’ti. So ‘‘kāraṇaṃ vadatī’’ti sallakkhetvā migapotakaṃ gahetvā migaṃ adāsīti. Nikatīti yogavasena vā māyāvasena vā apāmaṅgaṃ pāmaṅganti, amaṇiṃ maṇinti, asuvaṇṇaṃ suvaṇṇanti katvā patirūpakena vañcanaṃ. Sāciyogoti kuṭilayogo, etesaṃyeva ukkoṭanādīnametaṃ nāmaṃ. Tasmā – ukkoṭanasāciyogo, vañcanasāciyogo, nikatisāciyogoti, evamettha attho daṭṭhabbo. Keci aññaṃ dassetvā aññassa parivattanaṃ sāciyogoti vadanti. Taṃ pana vañcaneneva saṅgahitaṃ.
Among cutting and so forth, "cutting" means cutting off hands and so forth. Killing is causing death. Binding is binding with ropes and so forth. Plundering is of two kinds: ambush in the wilderness, and ambush in a thicket. When people traveling on a path are covered by snow at the time of a snowfall, and are robbed, this is ambush in the wilderness. When they are covered by thickets and so forth, and are robbed, this is ambush in a thicket. Robbery is said to be the act of looting villages and towns, etc. Violence is violent action. It is entering a house, placing a weapon on the chest of the people, and taking the goods desired. Thus, the recluse Gotama is abstinent from such cutting… up to… violence. Or, indeed, monks, in speaking praise of the Tathāgata, the worldling might speak thus.
Về những sự việc như cắt xẻo, v.v., "cắt xẻo" nghĩa là cắt tay và những việc tương tự. "Giết" nghĩa là giết chết. "Trói buộc" nghĩa là trói bằng dây thừng, v.v. "Cướp bóc" có hai loại: cướp trên núi tuyết và cướp trong bụi rậm. Cướp trên núi tuyết là khi tuyết rơi phủ kín đường, bọn cướp ẩn mình trong tuyết và tấn công những người đi đường. Cướp trong bụi rậm là khi bọn cướp ẩn mình trong bụi rậm, v.v. và tấn công. "Cướp phá" nghĩa là cướp bóc làng mạc, v.v. "Hành hung" nghĩa là hành động thô bạo. Xông vào nhà, kề dao vào ngực người ta và lấy đi những vật dụng mong muốn. Sa môn Gotama (Cồ Đàm) từ bỏ những việc như cắt xẻo... cho đến hành hung. Này các Tỳ kheo, kẻ phàm phu có thể ca ngợi Như Lai như vậy.
Chedanādīsu chedananti hatthacchedanādi. Vadhoti māraṇaṃ. Bandhoti rajjubandhanādīhi bandhanaṃ. Viparāmosoti himaviparāmoso, gumbaviparāmosoti duvidho. Yaṃ himapātasamaye himena paṭicchannā hutvā maggappaṭipannaṃ janaṃ musanti, ayaṃ himaviparāmoso. Yaṃ gumbādīhi paṭicchannā musanti, ayaṃ gumbaviparāmoso. Ālopo vuccati gāmanigamādīnaṃ vilopakaraṇaṃ. Sahasākāroti sāhasikakiriyā. Gehaṃ pavisitvā manussānaṃ ure satthaṃ ṭhapetvā icchitabhaṇḍānaṃ gahaṇaṃ. Evametasmā chedana…pe… sahasākārā paṭivirato samaṇo gotamoti. Iti vā hi, bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyyāti.
To this extent the lesser morality is finished.
Như vậy là đã hoàn tất Tiểu giới.
Ettāvatā cūḷasīlaṃ niṭṭhitaṃ hoti.
Description of the Middle Morality
Phần Giải Thích về Trung Giới
Majjhimasīlavaṇṇanā
11. Now, expanding on the middle morality, he says, "Whereas some honorable ones", and so forth. Here is the explanation of the plain words. "Offerings given in faith" are those things given having faith in action and result, in this world and the next world. It is not given thus thinking, 'This is my relative', or 'a friend', or 'he will repay this', or 'this was done by him before'. For gifts given in this way are not called offerings given in faith. "Foods" is merely the designation for the teaching; but in reality, it has been said that all this is eating foods given in faith, clothing oneself in robes, using dwelling places, and consuming medicines for the sick.
11. Bây giờ, để trình bày rộng về Trung giới, Đức Thế Tôn nói: "Hoặc như một số Sa môn, Bà la môn đáng kính...". Ở đây là phần giải thích những từ ngữ không rõ ràng. "Những vật thực do tín thí cúng dường" nghĩa là những vật thực được cúng dường do tin vào nghiệp và quả, đời này và đời sau. Nghĩa là không phải cúng dường với ý nghĩ: "Đây là bà con của ta", hoặc "là bạn bè của ta", hoặc "người này sẽ đáp lại", hoặc "người này đã từng làm điều này". Những vật cúng dường như vậy không được gọi là vật thực do tín thí. "Những vật thực" chỉ là phần đầu của bài kinh, nhưng về ý nghĩa, sau khi thọ dụng những vật thực do tín thí cúng dường, đắp y, sử dụng các trú xứ, dùng thuốc trị bệnh, tất cả những điều này đều đã được nói đến.
11. Idāni majjhimasīlaṃ vitthārento ‘‘yathā vā paneke bhonto’’tiādimāha. Tatrāyaṃ anuttānapadavaṇṇanā. Saddhādeyyānīti kammañca phalañca idhalokañca paralokañca saddahitvā dinnāni. ‘Ayaṃ me ñātī’ti vā, ‘mitto’ti vā, idaṃ paṭikarissati, idaṃ vā tena katapubbanti vā, evaṃ na dinnānīti attho. Evaṃ dinnāni hi na saddhādeyyāni nāma honti . Bhojanānīti desanāsīsamattametaṃ, atthato pana saddhādeyyāni bhojanāni bhuñjitvā cīvarāni pārupitvā senāsanāni sevamānā gilānabhesajjaṃ paribhuñjamānāti sabbametaṃ vuttameva hoti.
What is that? It is the root-stock-grown plants, whose undertaking they engage in. Then, showing this, he said, "the root-stock", and so forth. There, "root-stock" means turmeric, ginger, sweet flag, water lily, fever nut, black hellebore, fragrant root, and fragrant moss, and so forth. "Stem-cutting" means banyan, fig tree, wave-leafed fig tree, cluster fig tree, tree, and jujube tree, and so forth. "Joint-cutting" means sugarcane, bamboo, and reed, and so forth. "Top-cutting" means sesame, mustard, and hemp, and so forth. "Seed-grown-plants" means grains and beans and so forth. All this, when separated from the tree and capable of sprouting, is called "root-stock-grown". But that which is not separated from the tree and is not dry is called "plant-life". There, the undertaking of plant-life is a matter of expiation, the undertaking of root-stock-grown plants is a matter for confession.
"Ví như" là một từ không biến đổi. Ý nghĩa của nó là gì? Đó là những loại cây từ hạt giống và cây từ thân, mà (các vị ấy) tham gia vào việc trồng trọt. Sau đó, để chỉ rõ điều đó, Đức Thế Tôn nói "cây từ củ...". Trong đó, "cây từ củ" là nghệ, gừng, xương bồ, địa liền, ô đầu, khổ sâm, hương căn, địa đảm. "Cây từ thân" là cây đa, cây đề, cây sung, cây sộp, cây kacchaka, cây mộc qua. "Cây từ đốt" là mía, lau, tre. "Cây từ chồi" là hành, tỏi, diếp cá. "Cây từ hạt" là các loại ngũ cốc. Tất cả những cây này, khi đã tách rời khỏi cây mẹ và có khả năng mọc lại, được gọi là "cây từ hạt giống". Còn những cây chưa tách rời khỏi cây mẹ, chưa khô héo, được gọi là "cây từ thân". Trong đó, việc trồng cây từ thân là một học giới Ưng đối trị (Pācittiya), việc trồng cây từ hạt giống là một học giới Ưng tác ác (Dukkaṭa).
Seyyathidanti nipāto. Tassattho katamo so bījagāmabhūtagāmo, yassa samārambhaṃ anuyuttā viharantīti. Tato taṃ dassento mūlabījantiādimāha. Tattha mūlabījaṃ nāma haliddi, siṅgiveraṃ, vacā, vacattaṃ, ativisā, kaṭukarohiṇī, usīraṃ, bhaddamuttakanti evamādi. Khandhabījaṃ nāma assattho, nigrodho, pilakkho, udumbaro, kacchako, kapitthanoti evamādi. Phaḷubījaṃ nāma ucchu, naḷo, veḷūti evamādi. Aggabījaṃ nāma ajjakaṃ, phaṇijjakaṃ, hiriveranti evamādi. Bījabījaṃ nāma pubbaṇṇaṃ aparaṇṇanti evamādi. Sabbañhetaṃ rukkhato viyojitaṃ viruhanasamatthameva ‘‘bījagāmo’’ti vuccati. Rukkhato pana aviyojitaṃ asukkhaṃ ‘‘bhūtagāmo’’ti vuccati. Tattha bhūtagāmasamārambho pācittiyavatthu, bījagāmasamārambho dukkaṭavatthūti veditabbo.
12. The enjoyment of things stored is the enjoyment of what is stored. There, there are two kinds of discussion, that based on the discipline and that based on complete purification. As for the discussion based on the discipline, whatever food is received today becomes stored the next day, in the enjoyment of which there is an expiation. But having received it oneself and given it to novices, having caused what they received to be kept, it is allowable to consume it on the second day, but it is not complete purification.
12. "Thọ dụng vật tích trữ" là thọ dụng những vật đã tích trữ. Có hai cách nói về điều này, theo Luật và theo hạnh Đầu đà. Theo Luật, bất kỳ loại thức ăn nào được nhận hôm nay, nếu tích trữ qua đêm, thì phạm Ưng đối trị. Tuy nhiên, nếu thức ăn do mình nhận được đem cho các Sa di, rồi nhận lại từ họ và để qua đêm, đến ngày hôm sau thọ dụng thì được, nhưng không phải là hạnh Đầu đà.
12.Sannidhikāraparibhoganti sannidhikatassa paribhogaṃ. Tattha duvidhā kathā, vinayavasena ca sallekhavasena ca. Vinayavasena tāva yaṃ kiñci annaṃ ajja paṭiggahitaṃ aparajju sannidhikārakaṃ hoti, tassa paribhoge pācittiyaṃ . Attanā laddhaṃ pana sāmaṇerānaṃ datvā, tehi laddhaṃ ṭhapāpetvā dutiyadivase bhuñjituṃ vaṭṭati, sallekho pana na hoti.
The same method applies to the storage of drinks. There, drinks mean the eight drinks such as mango juice, and those that are similar to them. Their determination is stated in the Samantapāsādikā.
Về nước uống tích trữ cũng tương tự. Nước uống ở đây là tám loại nước uống như nước xoài, v.v., và những loại tương tự. Sự phân biệt về chúng đã được nói trong Samantapāsādikā (bộ Chú giải của Luật tạng).
Pānasannidhimhipi eseva nayo. Tattha pānaṃ nāma ambapānādīni aṭṭha pānāni, yāni ca tesaṃ anulomāni. Tesaṃ vinicchayo samantapāsādikāyaṃ vutto.
In the case of the storage of cloth, that which is not determined and not designated is both a storage and it ruins complete purification, this is a discussion of the method. But without exception, one should be content with three robes, having received a fourth, it should be given to another. If one is unable to give it to just anyone, but there is someone to whom one wishes to give it, who has gone for the purpose of study or questioning, as soon as he returns, it should be given, it is not allowable not to give it. But if there is a lack of robes, with a prospect existing, it is allowable to keep it for the time permitted. Due to the lack of needles, thread, and robe-makers, even beyond that, having performed a disciplinary act, it is allowable to keep it. But it is not allowable to keep it thinking, "When this becomes worn out, from where will I obtain such a one again", it is both a storage and it ruins complete purification.
Về y phục tích trữ, y không được quyết định, không được chú nguyện (để làm y dư), vừa là tích trữ, vừa làm mất hạnh Đầu đà, đây là cách nói có ẩn ý. Còn nói thẳng ra, thì phải bằng lòng với ba y, nếu nhận được cái thứ tư thì phải cho người khác. Nếu không thể cho bất kỳ ai, nhưng muốn cho người nào đó, người đó lại đi đâu để nghe pháp hoặc hỏi pháp, thì khi người đó trở về, phải cho ngay, không được giữ lại. Tuy nhiên, nếu y không đủ, thì được phép giữ lại trong thời gian cho phép với hy vọng (sẽ có y). Nếu không có kim, chỉ, và người may y, thì được phép làm các việc theo Luật (như cắt may) và giữ lại lâu hơn. Nhưng không được giữ lại với ý nghĩ: "Khi y này cũ, ta sẽ lấy đâu ra cái khác như thế này", vì đó là tích trữ, và làm mất hạnh Đầu đà.
Vatthasannidhimhi anadhiṭṭhitaṃ avikappitaṃ sannidhi ca hoti, sallekhañca kopeti, ayaṃ pariyāyakathā. Nippariyāyato pana ticīvarasantuṭṭhena bhavitabbaṃ, catutthaṃ labhitvā aññassa dātabbaṃ. Sace yassa kassaci dātuṃ na sakkoti, yassa pana dātukāmo hoti, so uddesatthāya vā paripucchatthāya vā gato, āgatamatte dātabbaṃ, adātuṃ na vaṭṭati. Cīvare pana appahonte satiyā paccāsāya anuññātakālaṃ ṭhapetuṃ vaṭṭati. Sūcisuttacīvarakārakānaṃ alābhena tato parampi vinayakammaṃ katvā ṭhapetuṃ vaṭṭati. ‘‘Imasmiṃ jiṇṇe puna īdisaṃ kuto labhissāmī’’ti pana ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
In the case of the storage of vehicles, vehicles mean a palanquin, a chariot, a cart, a litter, a sedan chair, and a carrying-chair; this is not a vehicle for a recluse. But footwear is indeed a vehicle for a recluse. For one monk, one for the forest, one for washing the feet, at most two pairs of footwear are allowable. Having received a third, it should be given to another. It is not allowable to keep it thinking, "When this becomes worn out, from where will I obtain another", it is both a storage and it ruins complete purification.
Về phương tiện tích trữ, phương tiện là xe kiệu, xe ngựa, xe bò, võng, kiệu, cáng; đây không phải là phương tiện của người xuất gia. Nhưng giày dép là phương tiện của người xuất gia. Một Tỳ kheo, một đôi dùng để đi vào rừng, một đôi dùng để rửa chân, tối đa là được có hai đôi giày. Nếu nhận được đôi thứ ba thì phải cho người khác. Không được giữ lại với ý nghĩ: "Khi đôi này cũ, ta sẽ lấy đâu ra đôi khác", vì đó là tích trữ, và làm mất hạnh Đầu đà.
Yānasannidhimhi yānaṃ nāma vayhaṃ, ratho, sakaṭaṃ, sandamānikā, sivikā, pāṭaṅkīti; netaṃ pabbajitassa yānaṃ. Upāhanā pana pabbajitassa yānaṃyeva. Ekabhikkhussa hi eko araññatthāya, eko dhotapādakatthāyāti, ukkaṃsato dve upāhanasaṅghāṭā vaṭṭanti. Tatiyaṃ labhitvā aññassa dātabbo. ‘‘Imasmiṃ jiṇṇe aññaṃ kuto labhissāmī’’ti hi ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
In the case of the storage of beds, "bed" means a couch. For one monk, one in the chamber, one for daytime, at most two couches are allowable. Having received more than that, it should be given to another monk or to the community; it is not allowable not to give it. It is both a storage and it ruins complete purification.
Về giường tích trữ, giường là một cái ghế dài. Một Tỳ kheo, một cái trong phòng, một cái ở chỗ sinh hoạt ban ngày, tối đa là được có hai cái ghế dài. Nếu nhận được thêm, thì phải cho Tỳ kheo khác, hoặc cho chúng Tăng; không được giữ lại. Đó là tích trữ, và làm mất hạnh Đầu đà.
Sayanasannidhimhi sayananti mañco. Ekassa bhikkhuno eko gabbhe, eko divāṭhāneti ukkaṃsato dve mañcā vaṭṭanti. Tato uttari labhitvā aññassa bhikkhuno vā gaṇassa vā dātabbo; adātuṃ na vaṭṭati. Sannidhi ca hoti, sallekhañca kopeti.
In the case of the storage of scents, when a monk has diseases such as itching, skin eruptions, and skin diseases, scents are allowable. Having had those scents brought, when that disease is calmed, they should be given to others who are sick, or be applied to doorway five-finger house fumigation, and so forth. But it is not allowable to keep it thinking, "When there is a disease again, they will be", it is both a storage and it ruins complete purification.
Về hương liệu tích trữ, khi Tỳ kheo bị các bệnh như ghẻ, ngứa, bệnh ngoài da, thì được phép dùng hương liệu. Sau khi đem những hương liệu đó về, khi bệnh đã khỏi, thì phải cho những người bệnh khác, hoặc đem xông ở cửa ra vào, nơi xông hương năm ngón tay, v.v. Nhưng không được giữ lại với ý nghĩ: "Khi nào bệnh lại, sẽ có sẵn", vì đó là tích trữ, và làm mất hạnh Đầu đà.
Gandhasannidhimhi bhikkhuno kaṇḍukacchuchavidosādiābādhe sati gandhā vaṭṭanti. Te gandhe āharāpetvā tasmiṃ roge vūpasante aññesaṃ vā ābādhikānaṃ dātabbā, dvāre pañcaṅguligharadhūpanādīsu vā upanetabbā. ‘‘Puna roge sati bhavissantī’’ti pana ṭhapetuṃ na vaṭṭati, sannidhi ca hoti, sallekhañca kopeti.
What is said as "food" should be understood as the remainder. For example, here a certain monk -- thinking, "at such and such a time it will be for benefit" -- has sesame, rice, green gram, black gram, coconut, salt, fish, meat, dried meat, ghee, molasses, pots, and so forth, brought and kept. In the rainy season, early in the morning, he has gruel cooked by the novices and consumes it, and says, "Novice, it is difficult to enter the village in the watery mud, go to such and such a family and announce that I am sitting in the monastery; bring curd and so forth from such and such a family". He sends him. Even when the monks say, "What, Venerable Sir, will you enter the village?", he says, "The village is difficult to enter now, friends." They say, "Let it be, Venerable Sir, you stay, we will seek alms and bring it". Then the novice also, having brought curd and so forth, and having prepared the meal and curry, offers it; even as he is consuming that, the attendants send the meal; from that also he consumes what is agreeable, what is agreeable. Then the monks, having taken almsfood, return, from that also he consumes what is agreeable, as much as fills his neck. Thus he spends even the four months. This is said to be – "the monk lives the life of a bald householder, not the life of a recluse". Such is what is called the storage of food.
"Vật thực" ở đây là những thứ còn lại sau khi đã nói. Ví dụ, có Tỳ kheo nghĩ: "Vào thời điểm đó sẽ có ích", rồi cho người đem về và cất giữ các thứ như mè, gạo, đậu xanh, đậu đen, dừa, muối, cá, thịt, thịt khô, dầu, đường phèn. Vào mùa mưa, ngay từ sáng sớm, Tỳ kheo bảo các Sa di nấu cháo, rồi thọ dụng, sau đó nói: "Sa di, lội bùn lầy vào làng rất khó, hãy đi đến nhà kia, nói rằng ta đang ở trong chùa; hãy mang sữa chua, v.v. từ nhà đó về". Ngay cả khi các Tỳ kheo hỏi: "Bạch Đại đức, Ngài sẽ vào làng à?", Tỳ kheo cũng nói: "Này các Hiền giả, bây giờ vào làng rất khó". Họ nói: "Thôi được, Đại đức, xin Ngài ở lại, chúng con sẽ đi khất thực rồi mang về". Rồi Sa di cũng mang sữa chua, v.v. về, chuẩn bị cơm và thức ăn, dâng lên, khi Tỳ kheo đang ăn, thì những người phục vụ cũng mang cơm đến, Tỳ kheo cũng ăn những thứ ngon lành từ đó. Rồi các Tỳ kheo mang đồ khất thực về, Tỳ kheo cũng ăn những thứ ngon lành từ đó, vừa đủ cổ họng. Cứ như vậy, Tỳ kheo sống qua bốn tháng. Vị Tỳ kheo này được gọi là: "Tỳ kheo sống đời sống cư sĩ trọc đầu, không phải đời sống Sa môn". Đó gọi là tích trữ vật thực.
Āmisanti vuttāvasesaṃ daṭṭhabbaṃ. Seyyathidaṃ, idhekacco bhikkhu – ‘‘tathārūpe kāle upakārāya bhavissatī’’ti tilataṇḍulamuggamāsanāḷikeraloṇamacchamaṃsavallūrasappitelaguḷabhājanādīni āharāpetvā ṭhapeti. So vassakāle kālasseva sāmaṇerehi yāguṃ pacāpetvā paribhuñjitvā ‘‘sāmaṇera, udakakaddame dukkhaṃ gāmaṃ pavisituṃ, gaccha asukaṃ kulaṃ gantvā mayhaṃ vihāre nisinnabhāvaṃ ārocehi; asukakulato dadhiādīni āharā’’ti peseti. Bhikkhūhi – ‘‘kiṃ, bhante, gāmaṃ pavisissathā’’ti vuttepi, ‘‘duppaveso, āvuso, idāni gāmo’’ti vadati. Te – ‘‘hotu, bhante, acchatha tumhe, mayaṃ bhikkhaṃ pariyesitvā āharissāmā’’ti gacchanti. Atha sāmaṇeropi dadhiādīni āharitvā bhattañca byañjanañca sampādetvā upaneti, taṃ bhuñjantasseva upaṭṭhākā bhattaṃ pahiṇanti, tatopi manāpaṃ manāpaṃ bhuñjati. Atha bhikkhū piṇḍapātaṃ gahetvā āgacchanti, tatopi manāpaṃ manāpaṃ gīvāyāmakaṃ bhuñjatiyeva. Evaṃ catumāsampi vītināmeti. Ayaṃ vuccati – ‘‘bhikkhu muṇḍakuṭumbikajīvikaṃ jīvati, na samaṇajīvika’’nti. Evarūpo āmisasannidhi nāma hoti.
But in the dwelling place of a monk, it is allowable to deposit one measure of rice, one lump of molasses, and a quarter-share of ghee, for the sake of thieves arriving at an unseasonable time. For they, not obtaining even that much of a food reception, might even take a life, therefore if there is not that much, it is allowable to have it brought and keep it. And at a time of discomfort, whatever is allowable here, it is allowable to consume that oneself also. But in the allowable hut, even if one keeps much, there is no storage. But for the Tathāgata, in respect of a measure of rice and so forth, or even whatever piece of cloth four hands in size, there is nothing kept thinking, "This will be for me today or tomorrow".
Tuy nhiên, Tỳ kheo được phép cất giữ tại trú xứ một đấu gạo, một cục đường phèn, một phần tư bơ, để phòng khi có trộm cướp bất ngờ. Vì nếu không có chút vật thực nào để bố thí, chúng có thể cướp đi cả tính mạng, vì vậy, nếu không có những thứ này, thì nên cho người đem về và cất giữ. Và trong trường hợp bệnh, thì được phép tự mình thọ dụng những thứ được phép. Còn trong cốc được phép, thì dù có cất giữ nhiều cũng không gọi là tích trữ. Còn Như Lai thì không hề cất giữ dù chỉ một đấu gạo, v.v., hay bất cứ thứ gì, dù chỉ là một mảnh vải nhỏ bằng bốn gang tay, với ý nghĩ: "Cái này sẽ dùng cho ta hôm nay hoặc ngày mai".
Bhikkhuno pana vasanaṭṭhāne ekā taṇḍulanāḷi, eko guḷapiṇḍo, catubhāgamattaṃ sappīti ettakaṃ nidhetuṃ vaṭṭati, akāle sampattacorānaṃ atthāya. Te hi ettakampi āmisapaṭisanthāraṃ alabhantā jīvitāpi voropeyyuṃ, tasmā sace ettakaṃ natthi, āharāpetvāpi ṭhapetuṃ vaṭṭati. Aphāsukakāle ca yadettha kappiyaṃ, taṃ attanāpi paribhuñjituṃ vaṭṭati. Kappiyakuṭiyaṃ pana bahuṃ ṭhapentassāpi sannidhi nāma natthi. Tathāgatassa pana taṇḍulanāḷiādīsu vā yaṃ kiñci caturatanamattaṃ vā pilotikakhaṇḍaṃ ‘‘idaṃ me ajja vā sve vā bhavissatī’’ti ṭhapitaṃ nāma natthi.
13. In spectacles, "dancing" means whatever dancing; even when going on the road, it is not allowable to look, stretching out the neck. The detailed determination here should be understood by the method stated in the Samantapāsādikā. As here, so in all the sections of the text connected with the training rules. From here on, even without stating this much, we will describe only the purpose in each place.
13. Về các trò biểu diễn, "múa" là bất kỳ loại múa nào, ngay cả khi đang đi trên đường, cũng không được phép ngoái cổ lại để xem. Ở đây, sự phân biệt chi tiết đã được nói trong Samantapāsādikā (bộ Chú giải của Luật tạng). Như ở đây, cũng như vậy trong tất cả các đoạn kinh liên quan đến học giới. Từ đây trở đi, dù không nói hết, chúng tôi sẽ chỉ giải thích những điểm cần thiết ở từng chỗ.
13. Visūkadassanesu naccaṃ nāma yaṃ kiñci naccaṃ, taṃ maggaṃ gacchantenāpi gīvaṃ pasāretvā daṭṭhuṃ na vaṭṭati. Vitthāravinicchayo panettha samantapāsādikāyaṃ vuttanayeneva veditabbo. Yathā cettha, evaṃ sabbesu sikkhāpadapaṭisaṃyuttesu suttapadesu. Ito parañhi ettakampi avatvā tattha tattha payojanamattameva vaṇṇayissāmāti.
The show is the theatrical assembly. The narrative is such as the battle of the Bharatas. Even to go to the place where it is being told is not allowable. Hand-clapping is a cymbal, some also say hand-clapping. Musical instruments is a heavy cymbal, some say it is the rousing of a dead body with a mantra. A drum placed on a stand is a square drum, some say it is a drum sound. 'Beautifying' is the showering down of actors, or making beautiful, it is said to be clever imagination. The Cāndāla's performance is playing with an iron ball, some also say it is the Cāndāla's play of washing clothes. The bamboo is playing after raising a bamboo.
"Biểu diễn" là các buổi biểu diễn của các nghệ sĩ. "Kể chuyện" là kể về các trận chiến trong sử thi Bhārata, v.v. Ngay cả việc đi đến nơi kể chuyện cũng không được phép. "Vỗ tay" là đánh chũm chọe bằng đồng, một số người gọi là vỗ tay theo nhịp. "Đánh trống" là đánh trống lớn, một số người nói là dùng thần chú để làm xác chết sống dậy. "Đánh đàn" là đánh đàn đáy bằng. "Hát hay" là hát hay, hoặc là tài ứng đối nhanh. "Xiếc" là trò chơi với quả cầu sắt, một số người nói là trò giặt giũ của người Chiên Đà La (hạ cấp). "Trồng chuối" là dựng cây tre lên rồi biểu diễn.
Pekkhanti naṭasamajjaṃ. Akkhānanti bhāratayujjhanādikaṃ. Yasmiṃ ṭhāne kathīyati, tattha gantumpi na vaṭṭati. Pāṇissaranti kaṃsatāḷaṃ, pāṇitāḷantipi vadanti. Vetāḷanti ghanatāḷaṃ, mantena matasarīruṭṭhāpanantipi eke. Kumbhathūṇanti caturassaambaṇakatāḷaṃ, kumbhasaddantipi eke. Sobhanakanti naṭānaṃ abbhokkiraṇaṃ, sobhanakaraṃ vā, paṭibhānacittanti vuttaṃ hoti. Caṇḍālanti ayoguḷakīḷā, caṇḍālānaṃ sāṇadhovanakīḷātipi vadanti. Vaṃsanti veḷuṃ ussāpetvā kīḷanaṃ.
Washing bones, in some regions, they do not cremate deceased relatives, but bury them and leave them. Then, knowing that their bodies have become putrid, they exhume them, wash the bones, anoint them with perfumes, and keep them. At the time of the constellations, they place the bones in one place and liquor and so forth in another, and while weeping and lamenting, they drink liquor. And it has been said: “There is, monks, in the southern regions, a bone-washing, where there is food, drink, things to be chewed, things to be eaten, things to be licked, things to be drunk, dancing, singing, and musical instruments. This, monks, is washing, I do not say that it does not exist.” (A. X. 107). Some, however, say that bone-washing is also washing bones with magic.
Tẩy rửa xương cốt, ở một số địa phương, người ta không hỏa táng người thân đã chết, mà chôn xuống đất rồi để đó. Khi biết thân xác của họ đã hư hoại, người ta mang hài cốt ra, rửa sạch, xức hương liệu rồi cất giữ. Đến ngày lễ hội, họ đặt hài cốt ở một nơi, rượu và các thứ khác ở một nơi, rồi than khóc, uống rượu. Như đã nói: "Này các Tỳ kheo, ở các địa phương phía Nam, có tục tẩy rửa xương cốt, ở đó có cả đồ ăn, đồ uống, đồ nhai, đồ ăn, đồ liếm, đồ uống, cả múa, hát, nhạc. Này các Tỳ kheo, đó là sự tẩy rửa, ta không nói là không có." Tuy nhiên, một số người lại nói rằng tẩy rửa xương cốt là dùng trò ảo thuật.
Dhovananti aṭṭhidhovanaṃ, ekaccesu kira janapadesu kālaṅkate ñātake na jhāpenti, nikhaṇitvā ṭhapenti. Atha nesaṃ pūtibhūtaṃ kāyaṃ ñatvā nīharitvā aṭṭhīni dhovitvā gandhehi makkhetvā ṭhapenti. Te nakkhattakāle ekasmiṃ ṭhāne aṭṭhīni ṭhapetvā ekasmiṃ ṭhāne surādīni ṭhapetvā rodantā paridevantā suraṃ pivanti. Vuttampi cetaṃ – ‘‘atthi, bhikkhave , dakkhiṇesu janapadesu aṭṭhidhovanaṃ nāma, tattha hoti annampi pānampi khajjampi bhojjampi leyyampi peyyampi naccampi gītampi vāditampi. Atthetaṃ, bhikkhave, dhovanaṃ, netaṃ natthīti vadāmī’’ti (a. ni. 10.107). Ekacce pana indajālena aṭṭhidhovanaṃ dhovanantipi vadanti.
Regarding elephant fights and the like, it is not proper for a monk either to fight with elephants and the like, or to make them fight, or to watch them fighting. Wrestling is hand-to-hand combat. Military exercises are where combat is seen. Counting of troops is the place for the enumeration of the force. Deployment of the army is the army encampment, the setting up of the army in formations like cart arrays, and so forth. Review of the troops is the viewing of the troops that has been declared in the manner of, "Three elephants are the rear elephant troop" and so forth (Pāc. 324).
Trong các trận đấu voi v.v..., Tỳ kheo không được phép đấu với voi v.v..., không được cho chúng đấu với nhau, không được xem chúng đấu. Đấu vật (Nibbuddha) là đấu vật của các lực sĩ. Chiến trận (Uyyodhika) là nơi diễn ra giao tranh. Duyệt binh (Balagga) là nơi kiểm tra quân số. Bày trận (Senābyūha) là nơi đóng quân, bố trí quân đội theo đội hình xe v.v... Duyệt đội ngũ (Anīkadassana) là xem đội ngũ được nói đến theo cách: "Ba con voi thuộc đội ngũ voi phía sau" v.v... (pāci. 324).
Hatthiyuddhādīsu bhikkhuno neva hatthiādīhi saddhiṃ yujjhituṃ, na te yujjhāpetuṃ, na yujjhante daṭṭhuṃ vaṭṭati. Nibbuddhanti mallayuddhaṃ. Uyyodhikanti yattha sampahāro dissati. Balagganti balagaṇanaṭṭhānaṃ. Senābyūhanti senāniveso, sakaṭabyūhādivasena senāya nivesanaṃ. Anīkadassananti – ‘‘tayo hatthī pacchimaṃ hatthānīka’’ntiādinā (pāci. 324) nayena vuttassa anīkassa dassanaṃ.
14. A basis of negligence abides here, thus it is a basis of negligence. Gambling and that being a basis of negligence, it is a basis of negligence through gambling. Because it has eight squares for each row, it is called eight-squared; the same principle applies to ten-squared. 'In the sky' means playing in the sky, as in the eight-squared and ten-squared boards. Avoiding-path means creating various paths and circles on the ground, and the game of avoiding those paths. 'Santika' is the game of Santika. They remove and place, with just the fingernail, playing pieces or pebbles that have been placed together, without moving them; if any of them move, it is a defeat; this word refers to such a game. 'Khalika' is playing dice on a gambling board. 'Ghaṭikā' is the game of hitting a short stick with a long stick. 'Salākahattha' is the game of smearing the hand with lacquer, or with red dye, or with flour-water, and striking it on the ground or on a wall, saying, “What shall it be?” and showing shapes of elephants, horses, and so forth. 'Akkha' is the game with balls. 'Paṅgacīra' refers to a leaf-pipe; they play while blowing on it. 'Vaṅkaka' is a small toy plow, a child’s plaything. 'Mokkhacikā' is the game of spinning around, either taking a stick in the air or placing the head on the ground and spinning upside down, this is said to be the game of turning over. 'Ciṅgulika' is a wheel made from palm leaves and the like, which spins when blown by the wind. 'Pattāḷhaka' is a leaf-pipe. They play measuring rice and the like with it. 'Rathaka' is a small chariot. 'Dhanuka' is just a small bow. 'Akkharikā' is the game of recognizing letters in the air or on the back. 'Manesikā' is the game of guessing thoughts. 'Yathāvajja' is the game of showing whatever fault, such as a limp, hunchback, and so forth, that one has adopted.
14. Nơi mà sự phóng dật tồn tại là chỗ vui chơi phóng dật. Cờ bạc và chỗ vui chơi phóng dật ấy là cờ bạc chỗ vui chơi phóng dật. Có tám ô theo mỗi hàng là bàn cờ tám ô, đối với bàn cờ mười ô cũng tương tự. Chơi trên không (Ākāsa) là chơi trên không như chơi cờ tám ô, cờ mười ô. Đường tránh (Parihārapatha) là vẽ các vòng tròn đường đi khác nhau trên mặt đất, là trò chơi mà người ta tránh các đường đi ở đó. Chơi bi (Santika) là trò chơi bi. Họ lấy móng tay di chuyển các viên bi hoặc viên sỏi được xếp ngay ngắn mà không làm chúng rung động, nếu có viên nào rung động thì thua, đó là tên gọi của trò chơi như vậy. Chơi xúc xắc (Khalika) là trò chơi xúc xắc trên bàn cờ. Ghaṭikā là trò chơi dùng gậy dài đánh vào gậy ngắn. Que vẽ (Salākahattha) là nhúng que vẽ vào nước nghệ tây, nước măng cụt, hoặc nước bột, rồi vẽ hình voi, ngựa v.v... trên mặt đất hoặc trên tường, hỏi "Đây là gì?" Chơi bi (Akkha) là chơi bi sắt. Ống sáo (Paṅgacīra) là ống sáo làm bằng lá, người ta thổi nó và chơi. Gậy cong (Vaṅkaka) là cái cày nhỏ để các cậu bé trong làng chơi. Xoay vòng (Mokkhacikā) là trò chơi xoay người, hoặc là cầm gậy trên không trung, hoặc là đặt đầu xuống đất rồi xoay người từ dưới lên trên. Trống gió (Ciṅgulika) là bánh xe làm bằng lá thốt nốt v.v... quay nhờ gió. Ống đo (Pattāḷhaka) là ống sáo làm bằng lá. Họ đo cát v.v... bằng ống đó và chơi. Xe nhỏ (Rathaka) là xe đồ chơi nhỏ. Cung nhỏ (Dhanuka) là cung đồ chơi nhỏ. Chữ cái (Akkharikā) là trò chơi nhận biết chữ cái trên không trung hoặc trên lưng. Đoán ý nghĩ (Manesikā) là trò chơi đoán điều người ta nghĩ trong tâm. Như khuyết điểm (Yathāvajja) là thể hiện khuyết điểm của người què, người còng, người gù v.v...
14. Pamādo ettha tiṭṭhatīti pamādaṭṭhānaṃ. Jūtañca taṃ pamādaṭṭhānañcāti jūtappamādaṭṭhānaṃ. Ekekāya pantiyā aṭṭha aṭṭha padāni assāti aṭṭhapadaṃ dasapadepi eseva nayo. Ākāsanti aṭṭhapadadasapadesu viya ākāseyeva kīḷanaṃ. Parihārapathanti bhūmiyaṃ nānāpathamaṇḍalaṃ katvā tattha tattha pariharitabbaṃ, pathaṃ pariharantānaṃ kīḷanaṃ. Santikanti santikakīḷanaṃ. Ekajjhaṃ ṭhapitā sāriyo vā sakkharāyo vā acālentā nakheneva apanenti ca upanenti ca, sace tattha kāci calati, parājayo hoti, evarūpāya kīḷāyetaṃ adhivacanaṃ. Khalikanti jūtaphalake pāsakakīḷanaṃ. Ghaṭikā vuccati dīghadaṇḍakena rassadaṇḍakaṃ paharaṇakīḷanaṃ. Salākahatthanti lākhāya vā mañjiṭṭhikāya vā piṭṭhodakena vā salākahatthaṃ temetvā – ‘‘kiṃ hotū’’ti bhūmiyaṃ vā bhittiyaṃ vā taṃ paharitvā hatthiassādirūpadassanakīḷanaṃ. Akkhanti guḷakīḷā. Paṅgacīraṃ vuccati paṇṇanāḷikaṃ, taṃ dhamantā kīḷanti. Vaṅkakanti gāmadārakānaṃ kīḷanakaṃ khuddakanaṅgalaṃ. Mokkhacikā vuccati samparivattanakīḷā, ākāse vā daṇḍakaṃ gahetvā bhūmiyaṃ vā sīsaṃ ṭhapetvā heṭṭhupariyabhāvena parivattanakīḷāti vuttaṃ hoti. Ciṅgulikaṃ vuccati tālapaṇṇādīhi kataṃ vātappahārena paribbhamanacakkaṃ. Pattāḷhakaṃ vuccati paṇṇanāḷikā. Tāya vālukādīni minantā kīḷanti. Rathakanti khuddakarathaṃ. Dhanukanti khuddakadhanumeva. Akkharikā vuccati ākāse vā piṭṭhiyaṃ vā akkharajānanakīḷā. Manesikā nāma manasā cintitajānanakīḷā. Yathāvajjaṃ nāma kāṇakuṇikhujjādīnaṃ yaṃ yaṃ vajjaṃ, taṃ taṃ payojetvā dassanakīḷā.
15. 'Āsandī' is a seat that exceeds the proper size. With "they dwell engaged," it means that in all cases, a statement of use has been made. 'Pallaṅka' is made by placing animal forms on the legs. 'Gonaka' is a large rug with long fleece; its hairs are said to be more than four fingers long. 'Cittaka' is a woolen coverlet, variegated with animal figures. 'Paṭikā' is a white woolen coverlet. 'Paṭalikā' is a thick woolen coverlet with flower designs. It is also called, 'the one with amalaka leaves'. 'Tūlikā' is a spread filled with one of three types of cotton filling. 'Vikatikā' is a woolen spread variegated with figures of lions, tigers, and so forth. 'Uddalomī' is a woolen spread with the nap on both sides; some say "with flowers raised on one side." 'Ekantalomī' is a woolen spread with the nap on one side. Some say "with flowers raised on both sides." 'Kaṭṭissa' is a coverlet made of silk embroidered with gems. 'Koseyya' is also a coverlet made of silk thread embroidered with gems. But it is said in the Vinaya that pure silk is allowed. However, in the Dīghanikāya Commentary, it is said, "Except for the 'Tūlikā,' all 'Gonaka' and the rest, embroidered with jewels, are not allowed."
15. Ghế dài (Āsandī) là ghế vượt quá kích thước. Sống chuyên tâm vào (Anuyuttā viharanti) liên quan đến điều này, nên ở tất cả các phần đều dùng cách nói ở thể đối cách. Giường (Pallaṅka) là giường có hình thú dữ ở chân. Tấm thảm lông dài (Gonaka), lông của nó dài hơn bốn ngón tay. Tấm thảm thêu (Cittaka) là tấm thảm len thêu hình thù khác nhau. Tấm thảm trắng (Paṭikā) là tấm thảm len trắng. Tấm thảm dày (Paṭalikā) là tấm thảm len dày có hoa, còn được gọi là tấm thảm hoa sen. Nệm (Tūlikā) là nệm nhồi đầy một trong ba loại bông. Tấm thảm có hình (Vikatikā) là tấm thảm len có hình sư tử, hổ v.v... Tấm thảm có tua hai bên (Uddalomī), một số người nói là "hoa hướng lên trên ở một bên". Tấm thảm có tua một bên (Ekantalomī), một số người nói là "hoa hướng lên trên ở cả hai bên". Tấm lót bằng lụa (Kaṭṭissa) là tấm lót bằng lụa Kosiya được khâu viền bằng đá quý. Tấm lót bằng tơ sống (Koseyya) là tấm lót bằng tơ sống được khâu viền bằng đá quý. Tuy nhiên, Kinh nói rằng tấm lót bằng lụa thuần túy thì được phép. Tuy nhiên, trong Chú giải Trường Bộ Kinh lại nói rằng "ngoại trừ nệm, tất cả các tấm thảm Gonaka v.v... được khâu viền bằng đá quý đều không được phép."
15.Āsandinti pamāṇātikkantāsanaṃ. Anuyuttā viharantīti idaṃ apekkhitvā pana sabbapadesu upayogavacanaṃ kataṃ. Pallaṅkoti pādesu vāḷarūpāni ṭhapetvā kato. Gonakoti dīghalomako mahākojavo, caturaṅgulādhikāni kira tassa lomāni. Cittakanti vānavicittaṃ uṇṇāmayattharaṇaṃ. Paṭikāti uṇṇāmayo setattharaṇo. Paṭalikāti ghanapupphako uṇṇāmayattharaṇo. Yo āmalakapattotipi vuccati. Tūlikāti tiṇṇaṃ tūlānaṃ aññatarapuṇṇā tūlikā. Vikatikāti sīhabyagghādirūpavicitro uṇṇāmayattharaṇo. Uddalomīti ubhayatodasaṃ uṇṇāmayattharaṇaṃ, keci ‘‘ekatouggatapuppha’’nti vadanti. Ekantalomīti ekatodasaṃ uṇṇāmayattharaṇaṃ. Keci ‘‘ubhatouggatapuppha’’nti vadanti. Kaṭṭissanti ratanaparisibbitaṃ koseyyakaṭṭissamayapaccattharaṇaṃ. Koseyyanti ratanaparisibbitameva kosiyasuttamayapaccattharaṇaṃ. Suddhakoseyyaṃ pana vaṭṭatīti vinaye vuttaṃ. Dīghanikāyaṭṭhakathāyaṃ pana ‘‘ṭhapetvā tūlikaṃ sabbāneva gonakādīni ratanaparisibbitāni na vaṭṭantī’’ti vuttaṃ.
'Kuttaka' is a woolen spread, suitable for sixteen dancing girls to stand and dance on. 'Hatthattharaṃ' and 'assatthara' are simply coverlets for the backs of elephants and horses. The same principle applies to the chariot coverlets. 'Ajinappaveṇī' is a rug made by sewing together goat skins to the size of a couch. 'Kadalīmigapavarapaccattharaṇa' means there is a skin of the Kadalī deer, and a superior coverlet made from that; that is, the best coverlet. They make that by spreading the Kadalī deer skin over a white cloth and sewing it together. 'Sauttaracchada' means with an upper covering, that is, together with a red canopy tied above. Even a white canopy is not allowed if there is an improper coverlet below, but if there is not, then it is allowed. 'Ubhatolohitakūpadhāna' means a headrest and a footrest, an entirely red support for the two sides of the bed, this is not permitted. But a single support that is red, or lotus-colored, or variegated on both sides, if it is of the proper size, is allowed. However, a large headrest is forbidden. Two that are not red are certainly allowed. After receiving that, it should be given to others. If one is unable to give, one may spread it crosswise on the bed and, having placed a coverlet on top, lie down. However, in regard to the 'Āsandī' and the rest, one should proceed in the manner already stated. It has been said, “I allow, monks, cutting off the legs of a high chair and using it, breaking the animal carvings of a couch and using it, unraveling a mattress to make a pillow, and making the remainder into a floor covering.” (Cūḷava. 297).
Tấm thảm lớn (Kuttaka) là tấm thảm len đủ cho mười sáu vũ nữ đứng múa. Tấm lót trên lưng voi, tấm lót trên lưng ngựa (Hatthattharaṃ assattharaṃ) là các tấm lót để lót trên lưng voi và ngựa. Đối với tấm lót trên xe (Rathatthare) cũng tương tự. Tấm da (Ajinappaveṇī) là tấm da dê được khâu lại bằng kích thước của cái giường. Tấm lót tốt nhất bằng da hươu Kadalī (Kadalīmigapavarapaccattharaṇa), da hươu Kadalī có thật, là tấm lót tốt nhất được làm bằng da đó; nghĩa là tấm lót thượng hạng. Người ta trải tấm da hươu Kadalī lên trên tấm vải trắng rồi khâu lại. Có lọng che phía trên (Sauttaracchadanti) nghĩa là có lọng màu đỏ được buộc phía trên. Lọng màu trắng cũng không được phép nếu có tấm lót không thích hợp ở dưới, nhưng được phép nếu không có. Có gối tựa màu đỏ ở cả hai bên (Ubhatolohitakūpadhāna) là gối tựa đầu và gối tựa chân, có gối tựa màu đỏ ở cả hai bên giường, cái này không thích hợp. Tuy nhiên, nếu chỉ có một cái gối tựa màu đỏ, màu hoa sen, hoặc có hình thù khác nhau ở cả hai bên, nếu đúng kích thước thì được phép. Nhưng gối tựa lớn thì bị cấm. Hai cái gối tựa không có màu đỏ thì được phép. Sau khi có được những thứ trên thì nên cho người khác. Nếu không thể cho, có thể trải ngang trên giường rồi đặt tấm lót lên trên và nằm. Đối với ghế dài v.v... nên thực hành theo cách đã nói. Như đã nói: "Này các Tỳ kheo, ta cho phép cắt chân ghế dài rồi dùng, phá bỏ hình thú dữ trên giường rồi dùng, tháo nệm ra làm gối, phần còn lại dùng làm tấm trải trên đất" (cūḷava. 297).
Kuttakanti soḷasannaṃ nāṭakitthīnaṃ ṭhatvā naccanayoggaṃ uṇṇāmayattharaṇaṃ. Hatthattharaṃ assattharanti hatthiassapiṭṭhīsu attharaṇaattharakāyeva. Rathattharepi eseva nayo. Ajinappaveṇīti ajinacammehi mañcappamāṇena sibbitvā katā paveṇī. Kadalīmigapavarapaccattharaṇanti kadalīmigacammaṃ nāma atthi, tena kataṃ pavarapaccattharaṇaṃ; uttamapaccattharaṇanti attho. Taṃ kira setavatthassa upari kadalīmigacammaṃ pattharitvā sibbetvā karonti. Sauttaracchadanti saha uttaracchadena, uparibaddhena rattavitānena saddhinti attho. Setavitānampi heṭṭhā akappiyapaccattharaṇe sati na vaṭṭati, asati pana vaṭṭati. Ubhatolohitakūpadhānanti sīsūpadhānañca pādūpadhānañcāti mañcassa ubhatolohitakaṃ upadhānaṃ, etaṃ na kappati. Yaṃ pana ekameva upadhānaṃ ubhosu passesu rattaṃ vā hoti padumavaṇṇaṃ vā vicitraṃ vā, sace pamāṇayuttaṃ, vaṭṭati. Mahāupadhānaṃ pana paṭikkhittaṃ. Alohitakāni dvepi vaṭṭantiyeva. Tato uttari labhitvā aññesaṃ dātabbāni. Dātuṃ asakkonto mañce tiriyaṃ attharitvā upari paccattharaṇaṃ datvā nipajjitumpi labhati. Āsandīādīsu pana vuttanayeneva paṭipajjitabbaṃ. Vuttañhetaṃ – ‘‘anujānāmi, bhikkhave, āsandiyā pāde chinditvā paribhuñjituṃ, pallaṅkassa vāḷe bhinditvā paribhuñjituṃ, tūlikaṃ vijaṭetvā bimbohanaṃ kātuṃ, avasesaṃ bhummattharaṇaṃ kātu’’nti (cūḷava. 297).
16. In regard to rubbing down and so forth, the body odor of infants who have come out of the mother's womb disappears by the time they are twelve years old; to remove the foul odor of their bodies, they rub them down with perfumed powder and the like; such rubbing down is not allowed. But resourceful infants are laid on the thighs and rubbed with oil, and to shape the hands, feet, thighs, navel, and so forth, they are massaged; such massaging is not allowed.
16. Trong việc xoa bóp v.v..., mùi hương của cơ thể trẻ sơ sinh khi ra khỏi bụng mẹ sẽ mất đi vào lúc mười hai tuổi, người ta xoa bóp bằng bột hương v.v... để khử mùi hôi của cơ thể chúng, việc xoa bóp như vậy không được phép. Tuy nhiên, người ta đặt những đứa trẻ có phước lên đùi, xoa dầu rồi nắn chỉnh hình dạng tay, chân, đùi, rốn v.v..., việc xoa bóp như vậy không được phép.
16. Ucchādanādīsu mātukucchito nikkhantadārakānaṃ sarīragandho dvādasavassapattakāle nassati, tesaṃ sarīraduggandhaharaṇatthāya gandhacuṇṇādīhi ucchādenti, evarūpaṃ ucchādanaṃ na vaṭṭati. Puññavante pana dārake ūrūsu nipajjāpetvā telena makkhetvā hatthapādaūrunābhiādīnaṃ saṇṭhānasampādanatthaṃ parimaddanti, evarūpaṃ parimaddanaṃ na vaṭṭati.
'Nhāpana' is the bathing of those same infants with perfumes and the like. 'Sambāhana' is the strengthening of the arms by hitting the hands and feet with clubs and the like, as with great wrestlers. 'Ādāsa' is any kind of mirror; it is not allowed to use it. 'Añjana' is simply decorative eye ointment. 'Mālā' is either a bound garland or an unbound garland. 'Vilepana' is anything that colors the skin. 'Mukhacuṇṇa' and 'mukhalepana' mean they apply clay paste to remove black spots and the like on the face; when the blood is stimulated by that, they apply plantain paste; when the ailment has been consumed by that, they apply 'tilakakka' paste; when the blood has subsided due to that, they apply turmeric paste; when the skin color has appeared due to that, they powder the face with face powder; all of that is not allowed.
Tắm (Nhāpana) là tắm cho những đứa trẻ đó bằng hương v.v... Xoa bóp (Sambāhana) là xoa bóp tay chân bằng chùy v.v... như các lực sĩ để làm cho bắp tay to ra. Gương (Ādāsa), bất kỳ loại gương nào cũng không được phép sử dụng. Phấn mắt (Añjana) là phấn mắt để trang điểm. Vòng hoa (Mālā) là vòng hoa đã kết hoặc chưa kết. Nước hoa (Vilepana) là bất kỳ thứ gì làm thay đổi màu da. Bột xoa mặt, kem thoa mặt (Mukhacuṇṇaṃ mukhalepanaṃ), người ta bôi bột đất sét lên mặt để khử mụn đen v.v..., khi máu đã lưu thông thì bôi bột chữa bệnh, khi bệnh đã được chữa khỏi thì bôi bột nghệ, khi máu đã lắng xuống thì bôi bột nghệ, khi màu da đã trở lại bình thường thì xoa mặt bằng bột xoa mặt, tất cả những thứ đó đều không được phép.
Nhāpananti tesaṃyeva dārakānaṃ gandhādīhi nhāpanaṃ. Sambāhananti mahāmallānaṃ viya hatthapāde muggarādīhi paharitvā bāhuvaḍḍhanaṃ. Ādāsanti yaṃ kiñci ādāsaṃ pariharituṃ na vaṭṭati. Añjananti alaṅkārañjanameva. Mālāti baddhamālā vā abaddhamālā vā. Vilepananti yaṃ kiñci chavirāgakaraṇaṃ. Mukhacuṇṇaṃ mukhalepananti mukhe kāḷapīḷakādīnaṃ haraṇatthāya mattikakakkaṃ denti, tena lohite calite sāsapakakkaṃ denti, tena dose khādite tilakakkaṃ denti, tena lohite sannisinne haliddikakkaṃ denti, tena chavivaṇṇe ārūḷhe mukhacuṇṇakena mukhaṃ cuṇṇenti, taṃ sabbaṃ na vaṭṭati.
Regarding hand ornaments and the like, they walk around with various ornamented conch shells and the like tied to their hands; that, or any other hand ornament, is not allowed; others walk around with their hair tied up. And they encircle it with golden threads, strings of pearls, and so forth; all of that is not allowed. Others carry a four-hand-long staff or any other ornamented staff, as well as a medicine case decorated with figures of women, men, and the like, wrapped well, slung on the left side; others carry a sword with a sheath encrusted with jewels, exceedingly sharp, a parasol decorated with a five-colored thread-sewn makara-tooth design and the like, and shoes adorned with various things like gold, silver, and peacock feathers; some, showing a haircut an inch long and four fingers wide, tie a turban band on the forehead like lightning in a cloud-face, wear a crest-jewel, carry a fly-whisk of yak-tail hair; all of that is not allowed.
Trong các đồ trang sức tay v.v..., người ta đeo vòng bằng vỏ sò v.v... trên tay, hoặc bất kỳ đồ trang sức tay nào khác, tất cả đều không được phép, một số người khác lại kết tóc. Họ trang trí tóc bằng sợi chỉ vàng, ngọc trai v.v...; tất cả những thứ đó đều không được phép. Một số người khác lại cầm gậy dài bốn hắc tay hoặc bất kỳ loại gậy được trang trí nào, cũng như ống thuốc có hình thù nam nữ được bọc kỹ, đeo ở bên trái; một số người khác lại mang theo kiếm rất sắc có bao kiếm nạm ngọc, ô có hình thù răng cá mập v.v... được khâu bằng chỉ ngũ sắc, quạt làm bằng lông công v.v... được trang trí bằng vàng, bạc v.v..., một số người khác lại khoe tóc cắt ngang trán, dài bằng viên ngọc, rộng bốn ngón tay, như tia chớp trong mây, đeo khăn xếp trên trán, đội mũ miện, cầm quạt phất trần, tất cả những thứ đó đều không được phép.
Hatthabandhādīsu hatthe vicitrasaṅkhakapālādīni bandhitvā vicaranti, taṃ vā aññaṃ vā sabbampi hatthābharaṇaṃ na vaṭṭati, apare sikhaṃ bandhitvā vicaranti. Suvaṇṇacīrakamuttalatādīhi ca taṃ parikkhipanti; taṃ sabbaṃ na vaṭṭati. Apare catuhatthadaṇḍaṃ vā aññaṃ vā pana alaṅkatadaṇḍakaṃ gahetvā vicaranti, tathā itthipurisarūpādivicittaṃ bhesajjanāḷikaṃ suparikkhittaṃ vāmapasse olaggitaṃ; apare kaṇṇikaratanaparikkhittakosaṃ atitikhiṇaṃ asiṃ, pañcavaṇṇasuttasibbitaṃ makaradantakādivicittaṃ chattaṃ, suvaṇṇarajatādivicitrā morapiñchādiparikkhittā upāhanā, keci ratanamattāyāmaṃ caturaṅgulavitthataṃ kesantaparicchedaṃ dassetvā meghamukhe vijjulataṃ viya nalāṭe uṇhīsapaṭṭaṃ bandhanti, cūḷāmaṇiṃ dhārenti, cāmaravālabījaniṃ dhārenti, taṃ sabbaṃ na vaṭṭati.
17. Discourse that is like that of beasts, because it is a hindrance to the paths to heaven and liberation, is called animal talk. Among such topics, talk about kings that begins "The Great King, Mandhata, Dhammasoka, were so powerful" is considered talk about kings. The same method applies to talk about robbers, and so on. Talk about them, as well as talk based on household life, that starts with, "This king is handsome, beautiful" is considered animal talk. However, talk that starts with "Even he, being so powerful, has come to destruction" remains within the scope of a meditation subject. In the case of robbers, talk based on household life is considered animal talk, thinking, "Deva the leader was so very powerful," "Meghamala was so very powerful," based on their actions. Even in war, regarding battles like the Bharata war, animal talk is talk motivated by the enjoyment of sensual pleasure, such as "So-and-so was killed by so-and-so in this way, struck in this way". However, talk that proceeds with "Even they have come to destruction" is always in the scope of a meditation subject. Moreover, in the case of food and so on, it is not proper to speak with the enjoyment of sensual pleasure, saying "We have eaten and consumed food that has such color, fragrance, taste, and touch". But it is proper to talk about such topics, making them purposeful, "Previously, we offered food, drink, clothing, bedding, garlands, and scents of such color and quality to virtuous people, and we made offerings at shrines". In the case of talking about relatives, it is not appropriate to speak with the enjoyment of, "Our relatives are brave and capable" or "In the past, we traveled in such varied vehicles". It is appropriate to speak about relatives by making it meaningful, saying, "Even those relatives of ours have come to destruction" or "In the past, we offered such footwear to the Sangha". It is not appropriate to speak about villages in terms of being well-arranged, badly-arranged, having abundant alms, or scarce alms, or with enjoyment, saying, "Those who live in such-and-such a village are brave and capable." It is proper to speak by making it meaningful, saying, "They have faith and confidence" or "They have come to destruction and decay." The same method applies to talking about towns, cities, and countries.
17. Những câu chuyện trở ngại, ngăn chặn con đường đạt được cõi trời (thiên giới) và giải thoát, là những câu chuyện tầm thường. Trong đó, những câu chuyện liên quan đến vua chúa, chẳng hạn như "Đại vương Sammata vĩ đại, Mandhātā vĩ đại, Asoka sùng đạo là người có uy đức lớn như vậy", được gọi là những câu chuyện về vua chúa. Tương tự như vậy với các câu chuyện về trộm cướp, v.v. Trong số đó, những câu chuyện nương tựa vào gia đình (thế tục) như "Vị vua kia đẹp trai, dễ nhìn", v.v., cũng là những câu chuyện tầm thường. Tuy nhiên, những câu chuyện khởi lên như "Ngay cả người có uy đức lớn như vậy cũng đi đến chỗ diệt vong", thì lại thiết lập được nền tảng cho sự thực hành (tu tập). Với những tên trộm, những câu chuyện nương tựa vào gia đình như "Mūladeva là người có uy đức lớn, Meghamālo là người có uy đức lớn, thật là dũng mãnh khi xét đến hành động của họ", là những câu chuyện tầm thường. Trong những trận chiến, như trận chiến Bhārata, v.v., những câu chuyện chỉ dựa trên sự ham muốn khoái lạc như "người này bị người kia giết như thế này, bị thương như thế này" là những câu chuyện tầm thường. Tuy nhiên, những câu chuyện khởi lên như "Ngay cả những người đó cũng đi đến chỗ diệt vong" thì ở mọi nơi, đều là nền tảng cho sự thực hành. Hơn nữa, đối với những thứ như thức ăn, v.v., không nên nói dựa trên sự ham muốn khoái lạc rằng "chúng ta đã ăn, đã uống những thứ có màu sắc, hương thơm, vị ngon và xúc chạm tuyệt vời như vậy". Nhưng nên nói một cách có ý nghĩa, có mục đích, rằng "trước đây, chúng ta đã cúng dường thức ăn, đồ uống, y phục, giường nằm, vòng hoa, hương liệu có màu sắc và các đặc tính tuyệt vời như vậy cho những người trì giới, chúng ta đã cúng dường bảo tháp". Đối với những câu chuyện về bà con, v.v., không nên nói dựa trên sự khoái lạc, rằng "bà con của chúng ta là những người dũng cảm, có năng lực" hoặc "trước đây, chúng ta đã đi lại bằng những loại xe cộ đa dạng như vậy". Nhưng nên nói một cách có ý nghĩa, có mục đích, rằng "ngay cả những người bà con đó của chúng ta cũng đã đi đến chỗ diệt vong" hoặc "trước đây, chúng ta đã cúng dường những đôi dép như vậy cho Tăng đoàn". Những câu chuyện về làng mạc cũng không nên nói dựa trên sự khoái lạc, chẳng hạn như "dựa trên việc làng được bố trí tốt hay không tốt, có đủ thức ăn hay đói kém" hoặc "dân làng kia là những người dũng cảm, có năng lực". Nhưng nên nói một cách có ý nghĩa, có mục đích, rằng "họ có đức tin, tịnh tín" hoặc "họ đã đi đến chỗ diệt vong". Đối với những câu chuyện về thị trấn, thành phố, quốc gia, v.v., cũng tương tự như vậy.
17. Aniyyānikattā saggamokkhamaggānaṃ tiracchānabhūtā kathāti tiracchānakathā. Tattha rājānaṃ ārabbha mahāsammato mandhātā dhammāsoko evaṃ mahānubhāvotiādinā nayena pavattā kathā rājakathā. Esa nayo corakathādīsu. Tesu asuko rājā abhirūpo dassanīyotiādinā nayena gehassitakathāva tiracchānakathā hoti. Sopi nāma evaṃ mahānubhāvo khayaṃ gatoti evaṃ pavattā pana kammaṭṭhānabhāve tiṭṭhati. Coresu mūladevo evaṃ mahānubhāvo, meghamālo evaṃ mahānubhāvoti tesaṃ kammaṃ paṭicca aho sūrāti gehassitakathāva tiracchānakathā. Yuddhepi bhāratayuddhādīsu asukena asuko evaṃ mārito, evaṃ viddhoti kāmassādavaseneva kathā tiracchānakathā. Tepi nāma khayaṃ gatāti evaṃ pavattā pana sabbattha kammaṭṭhānameva hoti. Api ca annādīsu evaṃ vaṇṇavantaṃ gandhavantaṃ rasavantaṃ phassasampannaṃ khādimha bhuñjimhāti kāmassādavasena kathetuṃ na vaṭṭati. Sātthakaṃ pana katvā pubbe evaṃ vaṇṇādisampannaṃ annaṃ pānaṃ vatthaṃ sayanaṃ mālaṃ gandhaṃ sīlavantānaṃ adamha, cetiye pūjaṃ karimhāti kathetuṃ vaṭṭati. Ñātikathādīsu pana ‘‘amhākaṃ ñātakā sūrā samatthā’’ti vā ‘‘pubbe mayaṃ evaṃ vicitrehi yānehi vicarimhā’’ti vā assādavasena vattuṃ na vaṭṭati. Sātthakaṃ pana katvā ‘‘tepi no ñātakā khayaṃ gatā’’ti vā ‘‘pubbe mayaṃ evarūpā upāhanā saṅghassa adamhā’’ti vā kathetuṃ vaṭṭati. Gāmakathāpi suniviṭṭhadunniviṭṭhasubhikkhadubbhikkhādivasena vā ‘‘asukagāmavāsino sūrā samatthā’’ti vā evaṃ assādavasena na vaṭṭati. Sātthakaṃ pana katvā ‘‘saddhā pasannā’’ti vā ‘‘khayavayaṃ gatā’’ti vā vattuṃ vaṭṭati. Nigamanagarajanapadakathādīsupi eseva nayo.
Even talk about women is not proper when it relates to the enjoyment of their form, figure, and so on. It is proper, in the same manner, saying they have faith and confidence, and have come to destruction and decay. Talk about heroes is also not appropriate if focused on the enjoyment of, "A warrior named Nandimitta was brave." It is proper to say that he had faith and has come to destruction. Talk about streets is also not appropriate with the enjoyment of, "Such-and-such streets are well-arranged, badly-arranged, full of brave and capable people." It is proper to say they have faith and confidence, and have come to destruction and decay.
Những câu chuyện về phụ nữ cũng không nên nói dựa trên sự khoái lạc, xét theo màu sắc, hình dáng, v.v., mà nên nói rằng họ có đức tin, tịnh tín, đã đi đến chỗ diệt vong. Những câu chuyện về anh hùng cũng không nên nói dựa trên sự khoái lạc, rằng "có một chiến binh tên là Nandimitta rất dũng cảm". Nên nói rằng người đó có đức tin, đã đi đến chỗ diệt vong. Những câu chuyện về đường phố cũng không nên nói dựa trên sự khoái lạc, rằng "con đường kia được bố trí tốt, không tốt, những người dũng cảm, có năng lực". Nên nói rằng họ có đức tin, tịnh tín, đã đi đến chỗ diệt vong.
Itthikathāpi vaṇṇasaṇṭhānādīni paṭicca assādavasena na vaṭṭati, saddhā pasannā khayavayaṃ gatāti evameva vaṭṭati. Sūrakathāpi ‘nandimitto nāma yodho sūro ahosī’ti assādavasena na vaṭṭati. Saddho ahosi khayaṃ gatoti evameva vaṭṭati. Visikhākathāpi ‘‘asukā visikhā suniviṭṭhā dunniviṭṭhā sūrā samatthā’’ti assādavasena na vaṭṭati. Saddhā pasannā khayavayaṃ gatāti evameva vaṭṭati.
Talk about watering places refers to talk about places where water is kept, also called talk about water fords, or talk about pot-carrying maidens. This talk is not proper when it relates to enjoyment such as, "She is skilled and clever at dancing and singing"; but it is proper using the method starting with, "She has faith and confidence." Talk about departed ancestors refers to talk about deceased relatives. The determination in this matter is similar to that regarding talk about living relatives.
Câu chuyện Kumbhaṭṭhāna là câu chuyện về nơi lấy nước, cũng được gọi là câu chuyện về bến nước, hoặc câu chuyện về người nữ tỳ mang bình, cũng không nên nói dựa trên sự khoái lạc, rằng "cô ấy xinh đẹp, giỏi múa hát"; mà nên nói theo cách có đức tin, tịnh tín, v.v. Câu chuyện Pubbapeta là câu chuyện về những người bà con đã khuất. Trong đó, cách phân xử cũng giống như câu chuyện về những người bà con hiện tại.
Kumbhaṭṭhānakathāti udakaṭṭhānakathā, udakatitthakathātipi vuccati, kumbhadāsikathā vā, sāpi ‘‘pāsādikā naccituṃ gāyituṃ chekā’’ti assādavasena na vaṭṭati; saddhā pasannātiādinā nayeneva vaṭṭati. Pubbapetakathāti atītañātikathā. Tattha vattamānañātikathāsadiso vinicchayo.
Diverse talk refers to varied talk, not included in the earlier or later topics, which is of various natures and without purpose. Worldly speculation is talk like "By whom was this world created?", "It was created by so-and-so." "Why are crows white? Because their bones are white." "Why are herons red? Because their blood is red." Worldly speculation is talk and prattle about materialist doctrines.
Câu chuyện Nānattā là những câu chuyện có tính chất khác nhau, vô nghĩa, không liên quan đến những câu chuyện trước và sau. Câu chuyện Lokakkhāyikā là câu chuyện "thế giới này do ai tạo ra, do người tên là Asuka tạo ra. Con quạ màu trắng, vì xương của nó màu trắng; con cò màu đỏ, vì máu của nó màu đỏ", v.v., những câu chuyện ngụy biện, tranh luận về thế giới.
Nānattakathāti purimapacchimakathāhi vimuttā avasesā nānāsabhāvā niratthakakathā. Lokakkhāyikāti ayaṃ loko kena nimmito, asukena nāma nimmito. Kāko seto, aṭṭhīnaṃ setattā; balākā rattā. Lohitassa rattattāti evamādikā lokāyatavitaṇḍasallāpakathā.
Talk about the sea refers to talk like, "Why is the sea called samudra or sagara? It was dug by Sagara, therefore it is called sagara. Because he himself indicated with a hand gesture that 'It was dug by me', it is called samudra". This is pointless talk about the sea. 'Existence' means growth. 'Non-existence' means decline. Talk that discusses existence and non-existence, resorting to any pointless reasoning, is called talk about existence and non-existence.
Câu chuyện Samuddakkhāyikā là "tại sao biển được gọi là sāgara (đại dương)? Vì nó được đào bởi thần Sāgara, nên được gọi là sāgara. Vì ngài đã tự mình thông báo bằng dấu hiệu tay rằng 'đã đào', nên được gọi là 'samudda'", v.v., những câu chuyện vô nghĩa về đại dương. Bhava là sự tăng trưởng. Abhava là sự suy giảm. Câu chuyện Itibhavābhava là những câu chuyện được nói ra bằng cách đưa ra bất kỳ lý do vô nghĩa nào, chẳng hạn như "đây là sự tăng trưởng, đây là sự suy giảm".
Samuddakkhāyikā nāma kasmā samuddo sāgaro? Sāgaradevena khato, tasmā sāgaro. Khato meti hatthamuddāya sayaṃ niveditattā ‘‘samuddo’’ti evamādikā niratthakā samuddakkhāyanakathā. Bhavoti vuḍḍhi. Abhavoti hāni. Iti bhavo, iti abhavoti yaṃ vā taṃ vā niratthakakāraṇaṃ vatvā pavattitakathā itibhavābhavakathā.
18. Disputatious talk means argumentative talk, the talk of contention. Herein, "coherent" means "my statement is coherent, connected, meaningful, and based on reason." "Incoherent" means "your statement is incoherent, unconnected." "What you have practiced has been overturned" means "what you have thoroughly mastered through long practice, has been overturned and refuted by my single statement, you do not know anything."
18. Câu chuyện Viggāhikā là câu chuyện tranh cãi, câu chuyện gây gổ. Trong đó, "sahitaṃ me" có nghĩa là "lời nói của ta có lý, mạch lạc, hợp lý, có lý do". "Asahitaṃ te" có nghĩa là "lời nói của ngươi không có lý, không mạch lạc". "Adhiciṇṇaṃ te viparāvattaṃ" có nghĩa là "những gì ngươi đã thuần thục do thực hành trong thời gian dài, đã bị đảo ngược, bị thay đổi bởi một lời nói của ta, ngươi không biết gì cả".
18.Viggāhikakathāti viggahakathā, sārambhakathā. Tattha sahitaṃ meti mayhaṃ vacanaṃ sahitaṃ siliṭṭhaṃ atthayuttaṃ kāraṇayuttanti attho. Asahitaṃ teti tuyhaṃ vacanaṃ asahitaṃ asiliṭṭhaṃ. Adhiciṇṇaṃ te viparāvattanti yaṃ tuyhaṃ dīgharattāciṇṇavasena suppaguṇaṃ, taṃ mayhaṃ ekavacaneneva viparāvattaṃ parivattitvā ṭhitaṃ, na kiñci jānāsīti attho.
"A charge has been laid against you" means "I have laid a charge against you". "Proceed to dispel the charge" means "proceed, wander around; go here and there to learn in order to dispel the charge." Or, "Refute it, if you are able," meaning, "If you are able, refute it now."
"Āropito te vādo" có nghĩa là "ta đã gán lỗi cho ngươi". "Cara vādappamokkhāyā" có nghĩa là "hãy đi, hãy du hành để thoát khỏi lỗi lầm; hãy đi đến nhiều nơi để học hỏi". "Nibbeṭhehi vā sace pahosī" có nghĩa là "nếu ngươi có khả năng, hãy giải thích ngay bây giờ".
Āropitote vādoti mayā tava doso āropito. Cara vādappamokkhāyāti dosamocanatthaṃ cara, vicara; tattha tattha gantvā sikkhāti attho. Nibbeṭhehi vā sace pahosīti atha sayaṃ pahosi, idānimeva nibbeṭhehīti.
19. Regarding messenger services: "Go there" means "Go from here to such-and-such a place". "Come here" means "Come from that place to such-and-such a place". "Carry this" means "Carry this thing from here". "Bring this here" means "Bring this thing here from such-and-such a place." In brief, this messenger service, except for the five matters pertaining to the Dhamma, those helpful to the Triple Gem, and the instructions for laypeople, is not permissible for others.
19. Trong câu chuyện Dūteyya, "idaṃ gaccha" có nghĩa là "hãy đi đến nơi tên là Asuka này". "Amutrāgaccha" có nghĩa là "hãy đến nơi tên là Asuka kia từ đó". "Idaṃ hara" có nghĩa là "hãy mang thứ này đi từ đây". "Amutra idaṃ āhara" có nghĩa là "hãy mang thứ này đến đây từ nơi tên là Asuka". Nói tóm lại, việc làm sứ giả này không thích hợp cho bất kỳ ai, ngoại trừ năm hạng người có giới luật tương đồng (sahadhammika) liên quan đến lợi ích của Tam Bảo, và việc truyền đạt mệnh lệnh của người cư sĩ.
19. Dūteyyakathāyaṃ idha gacchāti ito asukaṃ nāma ṭhānaṃ gaccha. Amutrāgacchāti tato asukaṃ nāma ṭhānaṃ āgaccha. Idaṃ harāti ito idaṃ nāma hara. Amutra idaṃ āharāti asukaṭṭhānato idaṃ nāma idha āhara. Saṅkhepato pana idaṃ dūteyyaṃ nāma ṭhapetvā pañca sahadhammike ratanattayassa upakārapaṭisaṃyuttañca gihīsāsanaṃ aññesaṃ na vaṭṭati.
20. "Deceitful" and other such terms mean those who deceive and bewilder the world with the threefold basis of deception are called deceivers. Those who, desiring gain and honor, prattle are called prattlers. Those whose practice is making predictions from signs are called predictors. Those whose practice is disparaging are called disparagers. Those who seek gain through gain, who seek and search for it, are called seekers of gain through gain. This is a designation for individuals endowed with deception, prattling, prediction, disparagement, and seeking gain through gain. This is the summary here. In detail, these deceptions and other matters have been explained in the Visuddhimagga, in the section on morality, by citing the Pali and the commentary.
20. Trong các từ Kuhakā, v.v., Kuhakā là những người lừa dối, làm cho thế gian kinh ngạc bằng ba loại phương tiện lừa dối. Lapakā là những người nói năng vì mong cầu lợi lộc và danh vọng. Nemittikā là những người có dấu hiệu (nimitta) là giới hạnh (sīla) của họ. Nippesikā là những người có sự xua đuổi (nippesa) là giới hạnh của họ. Lābhena lābhaṃ nijigīsitāro là những người tìm kiếm, săn đuổi lợi lộc bằng lợi lộc. Đây là những từ đồng nghĩa với những người có đầy đủ các đặc tính: lừa dối (kuhanā), nói năng (lapanā), làm dấu hiệu (nemittikatā), xua đuổi (nippesikatā), tìm kiếm lợi lộc bằng lợi lộc (lābhena lābhaṃ nijigīsanatā). Đây là phần tóm tắt. Về chi tiết, những sự lừa dối, v.v., này đã được trình bày rõ ràng trong Visuddhimagga (Thanh Tịnh Đạo), phần Sīlaniddesa (Chỉ dẫn về Giới), bằng cách trích dẫn cả Pāli và Chú giải.
20.Kuhakātiādīsu tividhena kuhanavatthunā lokaṃ kuhayanti, vimhāpayantīti kuhakā. Lābhasakkāratthikā hutvā lapantīti lapakā. Nimittaṃ sīlametesanti nemittikā. Nippeso sīlametesanti nippesikā. Lābhena lābhaṃ nijigīsanti magganti pariyesantīti lābhena lābhaṃ nijigīsitāro. Kuhanā, lapanā, nemittikatā, nippesikatā, lābhena lābhaṃ nijigīsanatāti etāhi samannāgatānaṃ puggalānaṃ etaṃ adhivacanaṃ. Ayamettha saṅkhepo. Vitthārena panetā kuhanādikā visuddhimagge sīlaniddeseyeva pāḷiñca aṭṭhakathañca āharitvā pakāsitāti.
With this, the Middle Morality is concluded.
Đến đây là kết thúc phần Majjhimasīla (Trung Giới).
Ettāvatā majjhimasīlaṃ niṭṭhitaṃ hoti.
Explanation of the Great Morality
Phần giải thích về Mahāsīla (Đại Giới)
Mahāsīlavaṇṇanā
21. Beyond this is the Great Morality. The science of limbs deals with how someone is endowed with any such limb, such as hands and feet, will have a long life and be famous, and so on. The science of signs is the science of bodily marks. It is said that the pale king held three mangoes in his fist and asked the predictor, "What is in my hand?" He looked here and there, and at that time, a house lizard, seizing a fly, ate the mangoes. He said, "Mangoes." Again, when asked, "How many?", he heard the sound of a cock crowing three times and said, "Three." In this way, people are engaged in signs, having examined this and that.
21. Từ đây trở đi là phần Mahāsīla (Đại Giới). Aṅga (chiêm tinh về các chi) là môn chiêm tinh được thực hành theo cách "người có đầy đủ các chi như tay, chân, v.v., như vậy sẽ sống lâu, có danh tiếng", v.v. Nimitta (chiêm tinh) là môn chiêm tinh về các dấu hiệu. Tương truyền, vua Paṇḍu nắm ba viên ngọc trong nắm tay và hỏi nhà chiêm tinh: "Trong tay ta có gì?". Người đó nhìn इधर-उधर (tả hữu), và vào lúc đó, một con ruồi bị con thạch sùng trong nhà bắt, viên ngọc, người đó nói "ngọc". Lại được hỏi "bao nhiêu?", người đó nghe tiếng gáy ba lần của con gà trống, liền nói "ba". Họ sống bằng cách thực hành chiêm tinh, tiên đoán những điều như vậy.
21. Ito paraṃ mahāsīlaṃ hoti. Aṅganti hatthapādādīsu yena kenaci evarūpena aṅgena samannāgato dīghāyu yasavā hotītiādinayappavattaṃ aṅgasatthaṃ. Nimittanti nimittasatthaṃ. Paṇḍurājā kira tisso muttāyo muṭṭhiyaṃ katvā nemittikaṃ pucchi – ‘‘kiṃ me hatthe’’ti? So ito cito ca vilokesi, tasmiñca samaye gharagolikāya makkhikā gayhantī muttā, so ‘‘muttā’’ti āha. Puna ‘‘katī’’ti puṭṭho kukkuṭassa tikkhattuṃ ravantassa saddaṃ sutvā ‘‘tisso’’ti āha. Evaṃ taṃ taṃ ādisitvā nimittamanuyuttā viharanti.
Portents refer to the falling of great things like thunderbolts and so on. Having seen them, they declare, "This will happen; it will happen in this way." Dreams refers to being engaged in interpreting dreams according to the way that "one who sees a dream in the early morning will have such-and-such a result; one who sees such-and-such a thing will have such-and-such a result." Marks refer to being endowed with this mark, one becomes a king; with this, a viceroy, and so on. Mouse-gnawed refers to something bitten by a rat. For even with a new or unworn cloth, they declare, starting from here, "If it is gnawed in this way, this will happen." Fire sacrifice refers to declaring, "With such wood, when this is sacrificed, this will happen". The oblations with a ladle and so on are also fire sacrifices. However, they are said separately due to the way they are performed such as, "With such a ladle, when such things as rice husks are sacrificed, this will happen".
Uppāta (điềm gở) là sự xuất hiện của những điềm gở lớn như sét đánh, v.v., sau khi nhìn thấy nó, họ tiên đoán "điều này sẽ xảy ra, điều kia sẽ xảy ra". Supina (giấc mơ) là họ sống bằng cách thực hành bói mộng, theo cách "ai thấy giấc mơ vào buổi sáng sớm, thì sẽ có kết quả như thế này; ai thấy điều này, thì điều kia sẽ xảy ra cho người đó", v.v. Lakkhaṇa (tướng) là "người có tướng này sẽ là vua, người có tướng kia sẽ là phó vương", v.v. Mūsikacchinna (vết chuột cắn) là ngay cả với một tấm vải chưa bị sờn hay đã bị sờn, họ cũng tiên đoán rằng "bắt đầu từ đây, nếu bị cắn như thế này, thì điều này sẽ xảy ra". Aggihoma (tế lửa) là việc tế lửa, "bằng loại gỗ như vậy, nếu được đốt như thế này, thì điều này sẽ xảy ra". Dabbihoma, v.v., cũng là tế lửa, nhưng được nói riêng vì cách thực hành khác nhau, chẳng hạn như "bằng loại muỗng như vậy, nếu các loại hạt, v.v., được đốt như thế này, thì điều này sẽ xảy ra".
Uppātanti asanipātādīnaṃ mahantānaṃ uppatitaṃ, tañhi disvā ‘‘idaṃ bhavissati, evaṃ bhavissatī’’ti ādisanti. Supinanti yo pubbaṇhasamaye supinaṃ passati, evaṃ vipāko hoti; yo idaṃ nāma passati, tassa idaṃ nāma hotītiādinā nayena supinakaṃ anuyuttā viharanti. Lakkhaṇanti iminā lakkhaṇena samannāgato rājā hoti, iminā uparājātiādikaṃ. Mūsikacchinnanti undūrakhāyitaṃ. Tenāpi hi ahate vā vatthe anahate vā vatthe ito paṭṭhāya evaṃ chinne idaṃ nāma hotīti ādisanti. Aggihomanti evarūpena dārunā evaṃ hute idaṃ nāma hotīti aggijuhanaṃ. Dabbihomādīnipi aggihomāneva, evarūpāya dabbiyā īdisehi kaṇādīhi hute idaṃ nāma hotīti evaṃ pavattivasena pana visuṃ vuttāni.
Herein, husks means rice husks. Grains are grains of both rice and grass. Clarified butter is clarified butter from cows and so on. Oil is sesame oil and so on. Mustard seeds and so forth are taken with the mouth and thrown into the fire. Reciting a spell and making an offering is called a mouth sacrifice. Sacrifice with blood from the knee-cap, knee, and so on, is a blood sacrifice. The science of limbs, mentioned earlier, was explained as declaring based on seeing a limb itself. Here, the science of limbs is explained as declaring, by reciting a spell upon seeing a knucklebone, whether this person is a member of a noble family or not, is endowed with good fortune or not. The science of building sites is the science of determining the good and bad qualities of house sites, park sites, and so on. By seeing the particular characteristics of the soil and reciting a spell, they see the good and bad qualities in an area thirty cubits below the earth and eighty cubits in the air. The science of warfare is knowledge of military treatises like Abbheyya, Asura, and Rakkhasa. The science of auspiciousness is a spell for creating protection, having entered a cemetery. It is also called the science of jackal howls. The science of spirits is a spell for exorcising spirits. The science of earth-houses is a spell to be learned by one dwelling in an earth-house. The science of snakes is both the science of treating snake bites and the science of summoning snakes. The science of poison is that by which either old poison is guarded against, new poison is created, or one is rendered poisonous. The science of scorpions is the treatment for scorpion stings. The same method applies to the science of mice. The science of birds is knowledge of birds based on the sounds, actions, and so on of birds, both winged and wingless, two-footed and four-footed. The science of crows is the knowledge of crow calls, which is a distinct science. Therefore, it is mentioned separately.
Trong đó, Kaṇa là cám gạo. Taṇḍula là gạo của các loại lúa, v.v., và các loại cỏ. Sappi là bơ lỏng (từ sữa bò), v.v. Tela là dầu mè, v.v. Việc cho mù tạt, v.v., vào miệng rồi ném vào lửa, hoặc tụng thần chú rồi tế, được gọi là Mukhahoma (tế bằng miệng). Việc tế bằng máu lấy từ khuỷu tay, đầu gối, v.v., được gọi là Lohitahoma (tế bằng máu). Aṅgavijjā (thuật xem tướng chi) là trước đây, chỉ nhìn thấy chi mà tiên đoán, nên được gọi là aṅga, còn ở đây, nhìn thấy đốt ngón tay rồi tụng thần chú, tiên đoán rằng người này có phải là con nhà dòng dõi hay không, có đầy đủ may mắn hay không, v.v., nên được gọi là aṅgavijjā. Vatthuvijjā (thuật xem tướng đất) là thuật xem xét các đặc tính tốt và xấu của đất làm nhà, đất làm vườn, v.v. Thậm chí chỉ nhìn thấy sự khác biệt của đất, v.v., họ cũng tụng thần chú và nhìn thấy các đặc tính tốt và xấu ở khu vực ba mươi sải tay dưới lòng đất, và tám mươi sải tay trên không trung. Khattavijjā (binh pháp) là sách về binh pháp, chẳng hạn như sách về chiến tranh với những người không sợ hãi, với những người Asura, những người Rakkhasa, v.v. Sivavijjā (thuật gọi hồn) là thần chú để làm yên, sau khi vào nghĩa địa, cũng được gọi là thần chú về tiếng hú của chó rừng. Bhūtavijjā (thuật trừ tà) là thần chú trừ tà. Bhūrivijjā (thuật giữ nhà) là thần chú mà người sống trong nhà có kho báu phải học. Ahivijjā (thuật về rắn) là thuật chữa trị vết rắn cắn và thuật gọi rắn. Visavijjā (thuật về độc) là thuật để bảo vệ khỏi chất độc cũ, hoặc tạo ra chất độc mới, hoặc làm cho người ta có độc. Vicchikavijjā (thuật về bọ cạp) là thuật chữa trị vết bọ cạp cắn. Mūsikavijjā (thuật về chuột) cũng tương tự. Sakuṇavijjā (thuật về chim) là sự hiểu biết về chim, dựa trên tiếng kêu, v.v., của các loài có cánh, không cánh, hai chân, bốn chân. Vāyasavijjā (thuật về quạ) là sự hiểu biết về tiếng quạ, đó là một môn học riêng, nên được nói riêng.
Tattha kaṇoti kuṇḍako. Taṇḍulāti sāliādīnañceva tiṇajātīnañca taṇḍulā. Sappīti gosappiādikaṃ. Telanti tilatelādikaṃ. Sāsapādīni pana mukhena gahetvā aggimhi pakkhipanaṃ, vijjaṃ parijappitvā juhanaṃ vā mukhahomaṃ. Dakkhiṇakkhakajaṇṇulohitādīhi juhanaṃ lohitahomaṃ. Aṅgavijjāti pubbe aṅgameva disvā byākaraṇavasena aṅgaṃ vuttaṃ, idha aṅgulaṭṭhiṃ disvā vijjaṃ parijappitvā ayaṃ kulaputto vā no vā, sirīsampanno vā no vātiādibyākaraṇavasena aṅgavijjā vuttā. Vatthuvijjāti gharavatthuārāmavatthādīnaṃ guṇadosasallakkhaṇavijjā. Mattikādivisesaṃ disvāpi hi vijjaṃ parijappitvā heṭṭhā pathaviyaṃ tiṃsaratanamatte, ākāse ca asītiratanamatte padese guṇadosaṃ passanti. Khattavijjāti abbheyyamāsurakkharājasatthādisatthaṃ. Sivavijjāti susāne pavisitvā santikaraṇavijjā, siṅgālarutavijjātipi vadanti. Bhūtavijjāti bhūtavejjamanto. Bhūrivijjāti bhūrighare vasantena uggahetabbamanto. Ahivijjāti sappadaṭṭhatikicchanavijjā ceva sappāvhāyanavijjā ca. Visavijjāti yāya, purāṇavisaṃ vā rakkhanti, navavisaṃ vā karonti visavantameva vā. Vicchikavijjāti vicchikadaṭṭhatikicchanavijjā. Mūsikavijjāyapi eseva nayo. Sakuṇavijjāti sapakkhakaapakkhakadvipadacatuppadānaṃ rutagatādivasena sakuṇañāṇaṃ. Vāyasavijjāti kākarutañāṇaṃ, taṃ visuññeva satthaṃ, tasmā visuṃ vuttaṃ.
Mental absorption means the thought that has reached maturity. The meaning is insightful knowledge that operates in such a way as “this one will live so long, that one so long”. Protection for all means protective spells, incantations for protection, to prevent harm from coming upon oneself. Knowledge of the cries of animals is said here as a general term encompassing all beasts, birds, and quadrupeds.
Tịnh-câu-trí (sự chín muồi của tư duy). Ở đây, ý nói là trí tuệ đã được chứng nghiệm, khởi lên như vầy: “vị này sẽ sống đến bằng này, vị kia đến bằng này”. Làm các phép trấn an, bảo hộ, là chú thuật khiến cho (tai họa) không đến với bản thân. Hiểu tiếng chim thú, ở đây nói chung bao gồm việc hiểu tiếng kêu của tất cả các loài chim và thú bốn chân.
Pakkajjhānanti paripākagatacintā. Idāni ‘‘ayaṃ ettakaṃ jīvissati, ayaṃ ettaka’’nti evaṃ pavattaṃ ādiṭṭhañāṇanti attho. Saraparittāṇanti sararakkhaṇaṃ, yathā attano upari na āgacchati, evaṃ karaṇavijjā. Migacakkanti idaṃ sabbasaṅgāhikaṃ sabbasakuṇacatuppadānaṃ rutañāṇavasena vuttaṃ.
22. Regarding gem characteristics and so forth, the meaning is engaging in the characteristics of gems and so forth based on color, shape, and so forth, saying, "A gem of such a type is auspicious, such a type is inauspicious, it is the cause of the owner’s health, prosperity, and so on, or it is not." There, weaponry means all other weapons except for swords and the like. The characteristics of women and so forth should be understood as the growth or decline of the family in which those women, men, and so on, live. Concerning the characteristics of goats and so forth, this distinction should be understood: the flesh of such goats and so forth should be eaten, the flesh of such should not be eaten.
22. Về ngọc-tướng (xem tướng ngọc) v.v..., có nghĩa là bận tâm, chuyên chú vào xem tướng của ngọc, v.v... với hình dạng, màu sắc, v.v... (để biết) như vầy: “viên ngọc có hình thù như thế này là tốt, hình thù như thế này là xấu, nó là nhân duyên cho sự khỏe mạnh, giàu sang của chủ nhân, hay không phải.” Ở đó, “vũ-khí” là nói đến những thứ như đao, v.v... còn lại là “khí-giới”. “Nữ-tướng” (xem tướng phụ nữ), v.v... nên biết theo sự thịnh suy của gia tộc mà những người nữ, người nam này, v.v... cư ngụ. Về “dương-tướng” (xem tướng dê), v.v... thì có sự đặc biệt này cần phải hiểu: thịt của những con dê, v.v... có hình tướng như thế này thì nên ăn, có hình tướng như thế này thì không nên ăn.
22.Maṇilakkhaṇādīsu evarūpo maṇi pasattho, evarūpo apasattho, sāmino ārogyaissariyādīnaṃ hetu hoti, na hotīti, evaṃ vaṇṇasaṇṭhānādivasena maṇiādīnaṃ lakkhaṇaṃ anuyuttā viharantīti attho. Tattha āvudhanti ṭhapetvā asiādīni avasesaṃ āvudhaṃ. Itthilakkhaṇādīnipi yamhi kule te itthipurisādayo vasanti, tassa vuḍḍhihānivaseneva veditabbāni. Ajalakkhaṇādīsu pana evarūpānaṃ ajādīnaṃ maṃsaṃ khāditabbaṃ, evarūpānaṃ na khāditabbanti ayaṃ viseso veditabbo.
Furthermore, concerning the characteristics of monitor lizards, and also in relation to patterns, adornments, and so forth, this distinction should be understood: when there is a monitor lizard of such a type, such and such will occur. And here is a story: In a certain monastery, they made a monitor lizard image in the artwork while fanning the fire. After that, a great dispute arose among the monks. A visiting monk, seeing it, painted over it. From then on, the dispute subsided. Characteristics of rings should be understood as both the type of ornamental ring and the type of house beam. Characteristics of turtles is similar to the characteristics of monitor lizards. Characteristics of deer is said to be a general term, based on the characteristics of all quadrupeds.
Thêm nữa, ở đây, trong “kỳ-đà-tướng” (xem tướng kỳ đà), ngay cả trong các loại tranh vẽ, đồ trang sức, v.v... có sự đặc biệt này cần phải hiểu, như khi thấy con kỳ đà có hình tướng như thế này thì việc này sẽ xảy ra. Và đây là câu chuyện ở đây - nghe nói tại một tu viện nọ, người ta đã đốt một con kỳ đà trong một bức tranh vẽ. Kể từ đó, các Tỳ-kheo đã tranh cãi dữ dội. Một vị Tỳ-kheo khách tăng nhìn thấy vậy đã bôi xóa nó đi. Kể từ đó sự tranh cãi lắng xuống. "Vành tai-tướng" (xem tướng khoen tai) nên hiểu theo cả khoen tai trang sức lẫn khoen tai ở nhà. "Quy-tướng" (xem tướng rùa) thì tương tự như "kỳ-đà-tướng" (xem tướng kỳ đà). "Thú-tướng" (xem tướng các loài thú) ở đây nói chung bao gồm việc xem tướng tất cả các loài thú bốn chân.
Api cettha godhāya lakkhaṇe cittakammapiḷandhanādīsupi evarūpāya godhāya sati idaṃ nāma hotīti ayaṃ viseso veditabbo. Idañcettha vatthu – ekasmiṃ kira vihāre cittakamme godhaṃ aggiṃ dhamamānaṃ akaṃsu. Tato paṭṭhāya bhikkhūnaṃ mahāvivādo jāto. Eko āgantukabhikkhu taṃ disvā makkhesi. Tato paṭṭhāya vivādo mandībhūto hoti. Kaṇṇikalakkhaṇaṃ piḷandhanakaṇṇikāyapi gehakaṇṇikāyapi vasena veditabbaṃ. Kacchapalakkhaṇaṃ godhālakkhaṇasadisameva. Migalakkhaṇaṃ sabbasaṅgāhikaṃ sabbacatuppadānaṃ lakkhaṇavasena vuttaṃ.
23. "The kings will depart" means he proclaims the going forth of kings, saying, "On such and such a day, under such and such a lunar mansion, a king of such and such a name will depart." This method applies everywhere. However, here, non-departure means return from a journey. "There will be an approach of the inner kings, there will be a retreat of the outer kings" means that in the inner city, our king will approach the opposing outer king, then there will be his retreat; in this way he proclaims the approach and retreat of kings. In the second statement, the method is the same. Victory and defeat are evident.
23. Tiên đoán rằng "Vua sẽ xuất chinh", nghĩa là tiên đoán về sự ra đi chinh chiến của các vị vua, như vầy: "Vào ngày đó, với chòm sao đó, vua tên là A-mâu sẽ xuất chinh". Cũng theo cách đó trong tất cả các trường hợp. Ở đây, "bất xuất chinh" nghĩa là quay trở về sau khi đã ra đi. "Vua trong nước sẽ tiến, vua ngoài nước sẽ lui", nghĩa là tiên đoán về sự tiến, lui của các vị vua như vầy: "Vua của chúng ta trong kinh thành sẽ tiến đến vị vua địch ở ngoài, từ đó ngài sẽ rút lui". Trong cụm từ thứ hai cũng theo cách đó. Còn "thắng và bại" thì đã rõ ràng.
23.Raññaṃ niyyānaṃ bhavissatīti asukadivase asukanakkhattena asukassa nāma rañño niggamanaṃ bhavissatīti evaṃ rājūnaṃ pavāsagamanaṃ byākaroti. Esa nayo sabbattha. Kevalaṃ panettha aniyyānanti vippavutthānaṃ puna āgamanaṃ. Abbhantarānaṃ raññaṃ upayānaṃ bhavissati, bāhirānaṃ raññaṃ apayānanti antonagare amhākaṃ rājā paṭiviruddhaṃ bahirājānaṃ upasaṅkamissati, tato tassa paṭikkamanaṃ bhavissatīti evaṃ raññaṃ upayānāpayānaṃ byākaroti. Dutiyapadepi eseva nayo. Jayaparājayā pākaṭāyeva.
24. Eclipses of the moon and so forth should be understood based on proclaiming that on such and such a day Rahu will seize the moon. Moreover, the conjunction of a lunar mansion with the afflictions of Mars and so forth is also an eclipse of the lunar mansion. Meteorites mean the falling of meteorites from the sky. Burning of the directions means the directions are sullied, as if the state is beset by flames, smoke, and the like. Divine thunder means the thunder of a dry cloud. Rising means emergence. Setting means disappearance. Defilement means impurity. Purification means purity. Such is the result means such various kinds of happiness and suffering for the world.
24. Về nguyệt-thực (nhật thực), v.v..., nên hiểu theo nghĩa tiên đoán như vầy: "Vào ngày đó, La-hầu sẽ nuốt mặt trăng". Thêm nữa, sự kết hợp của chòm sao với các hành tinh như Hỏa tinh, v.v..., cũng là "tinh-thực" (sao thực). "Vẫn-thạch" (sao băng) là sự rơi xuống của các thiên thạch từ trên trời. "Phương-tướng" (xem tướng phương hướng) là trạng thái u ám, vẩn đục của các phương hướng, như thể bị bao phủ bởi ngọn lửa, khói, v.v... "Sấm-thiên" (sấm sét) là tiếng sấm của những đám mây khô. "Thăng" (mọc) là sự xuất hiện. "Giáng" (lặn) là sự biến mất. "Ô-nhiễm" (ô nhiễm) là sự không trong sạch. "Thanh-tịnh" (thanh tịnh) là sự trong sạch. "Như vầy sẽ trổ quả", là (dự đoán về) những khổ, vui khác nhau như vậy của thế gian.
24.Candaggāhādayo asukadivase rāhu candaṃ gahessatīti byākaraṇavaseneva veditabbā. Api ca nakkhattassa aṅgārakādigāhasamāyogopi nakkhattagāhoyeva. Ukkāpātoti ākāsato ukkānaṃ patanaṃ. Disāḍāhoti disākālusiyaṃ aggisikhadhūmasikhādīhi ākulabhāvo viya. Devadudrabhīti sukkhavalāhakagajjanaṃ. Uggamananti udayanaṃ. Okkamananti atthaṅgamanaṃ. Saṃkilesanti avisuddhatā. Vodānanti visuddhatā. Evaṃ vipākoti lokassa evaṃ vividhasukhadukkhāvaho.
25. Good rain means the proper bestowal of rain by the deity. Bad rain means obstruction, that is, the restriction of rain. Counting on fingers means hand gestures. Calculation is called counting without error. Accounting means bulk counting by combining, forming groups, and so forth. One who is skilled in that can even see a tree and know how many leaves are on it. Poetry means the making of poetry for the sake of livelihood, based on one's own thought by the four kinds of poets, O monks. Which four? The thought-poet, the sound-poet, the meaning-poet, the spontaneous-poet. Or based on sound, having heard such things as, “There was a king named Vessantara,” and so on, or based on the meaning, thinking, "This is the meaning of that, I will explain it in this way," or based on spontaneous realization arising on the spot, thinking, "I will do what must be done appropriate to whatever I see". Cosmology is as already mentioned.
25. "Sung-vũ" (mưa thuận) là (việc) mưa xuống đúng thời. "Khiếm-vũ" (mưa nghịch) là không có mưa, nghĩa là hạn hán. "Thủ-ấn" (dấu tay). "Tính-toán" (đếm) là sự đếm các vật rời. "Tổng-kế" (tính gộp) là sự tính gộp, cộng dồn, v.v... Người nào thuần thục việc đó thì khi nhìn thấy một cái cây cũng biết được có bao nhiêu lá trên đó. "Thi-ca" (làm thơ): "Này các Tỳ-kheo, có bốn hạng thi sĩ này. Thế nào là bốn? Thi sĩ do tư duy, thi sĩ do nghe, thi sĩ do nghĩa, thi sĩ do ứng tác" (A. iv. 231). Trong bốn hạng thi sĩ này, (việc làm thơ) vì kế sinh nhai, hoặc theo sự tư duy của chính mình; hoặc sau khi nghe những điều như: "Có một vị vua tên là Vessantara (Tỳ-thủ-bà-đạt-la)", v.v..., theo sự nghe; hoặc theo nghĩa như: "Đây là nghĩa của cái này, ta sẽ giải thích nó như vậy"; hoặc theo sự ứng tác tức thời như: "Ta sẽ làm một bài thơ tương ứng với bất cứ thứ gì ta thấy". "Thuận-thế" (duy thế luận) thì đã được nói đến rồi.
25.Suvuṭṭhikāti devassa sammādhārānuppavecchanaṃ. Dubbuṭṭhikāti avaggāho, vassavibandhoti vuttaṃ hoti. Muddāti hatthamuddā. Gaṇanā vuccati acchiddakagaṇanā. Saṅkhānanti saṅkalanasaṭuppādanādivasena piṇḍagaṇanā. Yassa sā paguṇā hoti, so rukkhampi disvā ettakāni ettha paṇṇānīti jānāti. Kāveyyanti ‘‘cattārome, bhikkhave, kavī. Katame cattāro? Cintākavi, sutakavi, atthakavi, paṭibhānakavī’’ti (a. ni. 4.231). Imesaṃ catunnaṃ kavīnaṃ attano cintāvasena vā; ‘‘vessantaro nāma rājā ahosī’’tiādīni sutvā sutavasena vā; imassa ayaṃ attho, evaṃ taṃ yojessāmīti evaṃ atthavasena vā; kiñcideva disvā tappaṭibhāgaṃ kattabbaṃ karissāmīti evaṃ ṭhānuppattikapaṭibhānavasena vā; jīvikatthāya kabyakaraṇaṃ. Lokāyataṃ vuttameva.
26. Bringing means the act of bringing a girl from such and such a family, under such and such a lunar mansion, for this boy. Taking means the act of taking, saying, "Give this girl to a boy of such and such a name, under such and such a lunar mansion, thus there will be prosperity for her". Uniting means the act of uniting, saying, ‘Today the lunar mansion is excellent, be united today itself, thus you will not be separated.’ Separating means the act of separating, saying, ‘If you wish to be separated, separate today itself, thus you will not be united again.’ Accumulating means the accumulation of wealth, saying, ‘Accumulate wealth today, whether through effort or loan, for wealth accumulated today will become stable.’ Dispersing means the disbursing of wealth, saying, ‘If you wish to disburse wealth through lending, and so on, wealth disbursed today will become double or quadruple.’ Making fortunate means making dear and beloved, or making glorious. Making unfortunate is the opposite of that. Causing an opposing pregnancy means causing a pregnancy that is obstructed, shriveled, dead, or stuck. The meaning is giving medicine for the sake of non-destruction. For a pregnancy perishes due to three causes: wind, insects, and kamma. In that case, when it is perishing due to wind, he gives cooling medicine that quells it, when it is perishing due to insects, he performs treatment for the insects, but when it is perishing due to kamma, even the Buddhas are unable to prevent it.
26. "Nghênh-hôn" (đón dâu) là việc làm lễ đón dâu, như: "Hãy đưa cô dâu từ gia tộc A-mâu, với chòm sao A-mâu, về cho chú rể này". "Xuất-giá" (gả con) là việc làm lễ gả con, như: "Hãy gả cô dâu này cho chú rể tên là A-mâu, với chòm sao A-mâu, như vậy nàng sẽ được thịnh vượng". "Hòa-hợp" (làm cho hòa hợp), hòa-hợp là việc làm cho hòa hợp, như: "Hôm nay là ngày tốt, các người hãy hòa hợp ngay hôm nay, như vậy các người sẽ không chia lìa". "Phân-ly" (làm cho chia lìa) là việc làm cho chia lìa, như: "Nếu các người muốn chia lìa, hãy chia lìa ngay hôm nay, như vậy các người sẽ không còn gặp lại". "Tích-tụ" (gom góp) là việc thu gom tài sản, như: "Hãy thu gom tài sản đã cho mượn hay cho vay vào ngày hôm nay, vì tài sản được thu gom vào ngày hôm nay sẽ được bền vững". "Phân-tán" (phân phát) là việc cho vay tài sản, như: "Nếu các người muốn cho vay tài sản để sinh lợi, v.v..., hãy cho vay vào ngày hôm nay, vì tài sản cho vay vào ngày hôm nay sẽ tăng gấp đôi, gấp bốn". "Tác-phước" (làm cho có phước) là làm cho được yêu mến, hoặc làm cho có vẻ đẹp. "Tác-bất-phước" (làm cho không có phước) là ngược lại với điều đó. "Phá-thai" (phá thai) là việc làm cho cái thai bị hư, bị tiêu, bị chết cứng (trong bụng mẹ) bị hủy hoại. Ý nói là cho thuốc để không bị hư thai. Vì thai nhi bị hư hoại do ba nguyên nhân: do gió, do vi trùng, và do nghiệp. Trong đó, khi thai nhi bị hư hoại do gió, thì cho thuốc mát để làm cho yên; khi bị hư hoại do vi trùng, thì làm các phương pháp trị liệu vi trùng; còn khi bị hư hoại do nghiệp, thì ngay cả chư Phật cũng không thể ngăn chặn được.
26.Āvāhanaṃ nāma imassa dārakassa asukakulato asukanakkhattena dārikaṃ ānethāti āvāhakaraṇaṃ. Vivāhananti imaṃ dārikaṃ asukassa nāma dārakassa asukanakkhattena detha, evamassā vuḍḍhi bhavissatīti vivāhakaraṇaṃ. Saṃvaraṇanti saṃvaraṇaṃ nāma ‘ajja nakkhattaṃ sundaraṃ, ajjeva samaggā hotha, iti vo viyogo na bhavissatī’ti evaṃ samaggakaraṇaṃ. Vivaraṇaṃ nāma ‘sace viyujjitukāmattha, ajjeva viyujjatha , iti vo puna saṃyogo na bhavissatī’ti evaṃ visaṃyogakaraṇaṃ. Saṅkiraṇanti ‘uṭṭhānaṃ vā iṇaṃ vā dinnaṃ dhanaṃ ajja saṅkaḍḍhatha, ajja saṅkaḍḍhitañhi taṃ thāvaraṃ hotī’ti evaṃ dhanapiṇḍāpanaṃ. Vikiraṇanti ‘sace payogauddhārādivasena dhanaṃ payojitukāmattha, ajja payojitaṃ diguṇacatugguṇaṃ hotī’ti evaṃ dhanapayojāpanaṃ. Subhagakaraṇanti piyamanāpakaraṇaṃ vā sassirīkakaraṇaṃ vā. Dubbhagakaraṇanti tabbiparītaṃ. Viruddhagabbhakaraṇanti viruddhassa vilīnassa aṭṭhitassa matassa gabbhassa karaṇaṃ. Puna avināsāya bhesajjadānanti attho. Gabbho hi vātena, pāṇakehi, kammunā cāti tīhi kāraṇehi vinassati. Tattha vātena vinassante nibbāpanīyaṃ sītalaṃ bhesajjaṃ deti, pāṇakehi vinassante pāṇakānaṃ paṭikammaṃ karoti, kammunā vinassante pana buddhāpi paṭibāhituṃ na sakkonti.
Binding the tongue means binding the tongue with a mantra. Clenching the jaw means, with a mantra for mouth-binding, binding the jaw so that it cannot be moved. Hand-incantations means reciting spells for the sake of moving the hands. When that mantra is recited, standing within seven paces, the other throws his hand around. Ear-incantations means reciting an incantation so that sounds will not be heard by the ears. After reciting that, in a trial, he says whatever he wishes, the opponent does not hear it, therefore he is unable to produce a reply. Mirror questions means causing a deity to descend into a mirror and asking questions. Girl questions means causing a deity to descend into the body of a girl and asking questions. Deity questions means causing a deity to descend into the body of a servant girl and asking questions. Worship of the sun means worship of the sun for the sake of livelihood. Worship of the Great One means worship of the Great Brahma for the same reason. Fanning flames means producing flames of fire from the mouth with a mantra. Summoning of Siri means summoning Siri with “Come, Siri, be established on my head.”
"Trói-lưỡi" (làm câm) là việc ếm chú để trói lưỡi. "Khóa-hàm" (khóa miệng) là việc ếm chú để khóa miệng, khiến cho không thể cử động hàm. "Niệm-chú-ở-tay" (ếm chú vào tay) là việc niệm chú để xoay chuyển tay. Nghe nói, khi chú đó được niệm trong khi đứng cách bảy bước chân, người kia sẽ xoay tay và ném đi. "Niệm-chú-ở-tai" (niệm chú vào tai) là việc niệm chú để tai không thể nghe thấy âm thanh. Nghe nói, sau khi niệm chú đó, người ta nói bất cứ điều gì mình muốn ở nơi xét xử, người đối phương sẽ không nghe thấy, do đó không thể trả lời lại. "Vấn-kính" (hỏi gương) là việc thỉnh mời chư thiên nhập vào trong gương rồi hỏi các câu hỏi. "Vấn-đồng-nữ" (hỏi đồng nữ) là việc thỉnh mời chư thiên nhập vào thân đồng nữ rồi hỏi các câu hỏi. "Vấn-thiên" (hỏi chư thiên) là việc thỉnh mời chư thiên nhập vào thân người hầu gái rồi hỏi các câu hỏi. "Hầu-nhật" (thờ mặt trời) là sự thờ phụng mặt trời vì kế sinh nhai. "Hầu-đại" (thờ Phạm thiên) là sự thờ phụng Đại Phạm Thiên cũng vì như vậy. "Phun-lửa" (phun lửa) là việc dùng chú thuật để phun ra ngọn lửa từ miệng. "Chiêu-cát-tường" (gọi may mắn) là việc gọi mời sự may mắn bằng lời, như: "Hãy đến, hỡi sự may mắn, hãy ngự trên đầu của con".
Jivhānibandhananti mantena jivhāya bandhakaraṇaṃ. Hanusaṃhanananti mukhabandhamantena yathā hanukaṃ cāletuṃ na sakkonti, evaṃ bandhakaraṇaṃ. Hatthābhijappananti hatthānaṃ parivattanatthaṃ mantajappanaṃ. Tasmiṃ kira mante sattapadantare ṭhatvā jappite itaro hatthe parivattetvā khipati. Kaṇṇajappananti kaṇṇehi saddaṃ assavanatthāya vijjāya jappanaṃ. Taṃ kira jappitvā vinicchayaṭṭhāne yaṃ icchati, taṃ bhaṇati, paccatthiko taṃ na suṇāti, tato paṭivacanaṃ sampādetuṃ na sakkoti. Ādāsapañhanti ādāse devataṃ otāretvā pañhapucchanaṃ. Kumārikapañhanti kumārikāya sarīre devataṃ otāretvā pañhapucchanaṃ. Devapañhanti dāsiyā sarīre devataṃ otāretvā pañhapucchanaṃ. Ādiccupaṭṭhānanti jīvikatthāya ādiccapāricariyā. Mahatupaṭṭhānanti tatheva mahābrahmapāricariyā. Abbhujjalananti mantena mukhato aggijālānīharaṇaṃ. Sirivhāyananti ‘‘ehi siri, mayhaṃ sire patiṭṭhāhī’’ti evaṃ sirena siriyā avhāyanaṃ.
27. Making peace means going to a sacred place and making a vow for peace to be done at the time of success, saying, "If such and such is successful for me, I will make an offering to you with this and this." When that is successful, doing that is called making a vow. Abundant work means dwelling in an abundant house and performing rituals for the mantra obtained. Male-making means making a man, and neuter-making a neuter. Therefore, male-making is making a neuter into a male, and neuter-making is making a male into a neuter. However, one doing that only attains the state of lacking desire, he cannot cause the gender to disappear. House-site work means establishing a house on an unprepared site. House-site preparation means, saying "Bring this and this", performing the house-site offering. Rinsing means cleansing the mouth with water. Bathing means the bathing of others. Sacrificing means performing fire sacrifice for their sake. Vomiting means giving a concoction and causing vomiting. The method is the same for purging. Upward purging means the removal of impurities upwards. Downward purging means the removal of impurities downwards. Head purging means head cleansing. Ear-oil means cooking medicinal oil for the ears, for the sake of binding or removing wounds. Eye-lotion means oil for the eyes. Nose-work means performing nasal treatment after mixing with oil. Collyrium means a caustic collyrium capable of removing two or three cataracts. Cooling collyrium means a cooling medicinal collyrium. Minor surgery means the work of a minor surgeon. Major surgery means the work of a major surgeon. Child treatment is called the work of a pediatrician. Producing root medicines means showing bodily treatment with this. The removal of medicines means, after giving caustics and the like, and upon the appropriate wounds being healed, removing them.
27. "Tịch-sự" (việc cầu an) là việc hứa hẹn sẽ làm những việc cúng dường này, cúng dường kia, khi đến đền thờ chư thiên và nói rằng: "Nếu việc này của con thành tựu, con sẽ cúng dường cho các ngài vật này và vật kia". Khi việc đó thành tựu, việc thực hiện điều đó gọi là "thù-tạ-sự" (việc đền ơn). "Địa-sự" (việc đất đai) là việc thực hành các chú thuật đã được học sau khi ở trong một ngôi nhà nền đất. "Nam-sự", "nữ-sự" (việc nam tính/nữ tính), ở đây, "nam" (vass) là đàn ông, "nữ" (voss) là người không có giống nam (hoạn nhân). Như vậy, việc làm cho người không có giống nam thành đàn ông là "nam-sự", việc làm cho đàn ông thành người không có giống nam là "nữ-sự". Tuy nhiên, người làm việc đó chỉ đạt được trạng thái không có dục, chứ không thể làm mất đi giới tính. "Trạch-sự" (việc nhà cửa) là việc thiết lập nhà trên nền đất chưa được làm. "Trạch-tịnh-sự" (việc làm sạch nền nhà) là việc làm lễ cúng tế trên nền đất, sau khi nói: "Hãy mang đến vật này và vật kia". "Tẩy-khẩu" (rửa miệng) là việc làm cho miệng sạch bằng nước. "Tắm-rửa" (tắm rửa) là việc tắm rửa cho người khác. "Tế-hỏa" (cúng lửa) là việc cúng lửa cho những người đó. "Thôi-thổ" (làm cho nôn) là việc cho thuốc để gây nôn. Trong "nhuận-tràng" (làm cho đi ngoài) cũng như vậy. "Thượng-tẩy" (tẩy rửa bên trên) là việc đưa các chất ô uế ra ngoài từ phía trên. "Hạ-tẩy" (tẩy rửa bên dưới) là việc đưa các chất ô uế ra ngoài từ phía dưới. "Tẩy-đầu" (tẩy rửa đầu) là sự tẩy rửa đầu. "Tích-nhĩ" (nhỏ tai) là việc nấu dầu thuốc để chữa trị cho tai, hoặc để làm lành vết thương. "Tích-nhãn" (nhỏ mắt) là dầu nhỏ mắt. "Tích-tỵ" (nhỏ mũi) là việc nhỏ mũi sau khi pha chế với dầu. "Nhãn-dược" (thuốc nhỏ mắt) là thuốc nhỏ mắt có tính kiềm, có khả năng làm bong một, hai, hay ba lớp màng (trong mắt). "Giải-nhãn-dược" (thuốc giải độc mắt) là thuốc nhỏ mắt có tính mát để làm dịu. "Xỉ-trị" (chữa răng) là việc chữa trị bằng cây tăm. "Giải-phẫu" (phẫu thuật) là việc chữa trị bằng phẫu thuật. "Nhi-trị" (chữa bệnh cho trẻ con) là việc chữa trị cho trẻ em. "Cấp-dược-căn" (cấp thuốc gốc) là nói về việc chữa trị cho thân thể. "Giải-dược" (giải thuốc) là việc loại bỏ (các loại thuốc) sau khi cho các chất như chất kiềm, v.v..., khi vết thương đã lành theo (tác dụng của thuốc).
27.Santikammanti devaṭṭhānaṃ gantvā sace me idaṃ nāma samijjhissati, tumhākaṃ iminā ca iminā ca upahāraṃ karissāmīti samiddhikāle kattabbaṃ santipaṭissavakammaṃ. Tasmiṃ pana samiddhe tassa karaṇaṃ paṇidhikammaṃ nāma. Bhūrikammanti bhūrighare vasitvā gahitamantassa payogakaraṇaṃ. Vassakammaṃ vossakammanti ettha vassoti puriso, vossoti paṇḍako . Iti vossassa vassakaraṇaṃ vassakammaṃ, vassassa vossakaraṇaṃ vossakammaṃ. Taṃ pana karonto acchandikabhāvamattaṃ pāpeti, na liṅgaṃ antaradhāpetuṃ sakkoti. Vatthukammanti akatavatthusmiṃ gehapatiṭṭhāpanaṃ. Vatthuparikammanti ‘‘idañcidañcāharathā’’ti vatvā vatthubalikammakaraṇaṃ. Ācamananti udakena mukhasuddhikaraṇaṃ. Nhāpananti aññesaṃ nhāpanaṃ. Juhananti tesaṃ atthāya aggijuhanaṃ. Vamananti yogaṃ datvā vamanakaraṇaṃ. Virecanepi eseva nayo. Uddhaṃvirecananti uddhaṃ dosānaṃ nīharaṇaṃ. Adhovirecananti adho dosānaṃ nīharaṇaṃ. Sīsavirecananti sirovirecanaṃ. Kaṇṇatelanti kaṇṇānaṃ bandhanatthaṃ vā vaṇaharaṇatthaṃ vā bhesajjatelapacanaṃ. Nettatappananti akkhitappanatelaṃ. Natthukammanti telena yojetvā natthukaraṇaṃ. Añjananti dve vā tīṇi vā paṭalāni nīharaṇasamatthaṃ khārañjanaṃ. Paccañjananti nibbāpanīyaṃ sītalabhesajjañjanaṃ. Sālākiyanti salākavejjakammaṃ. Sallakattiyanti sallakattavejjakammaṃ. Dārakatikicchā vuccati komārabhaccavejjakammaṃ. Mūlabhesajjānaṃ anuppādananti iminā kāyatikicchanaṃ dasseti. Osadhīnaṃ paṭimokkhoti khārādīni datvā tadanurūpe vaṇe gate tesaṃ apanayanaṃ.
With this, the Great Morality is concluded.
Đến đây là kết thúc phần Đại giới.
Ettāvatā mahāsīlaṃ niṭṭhitaṃ hoti.
The Explanation of the Views of Eternalism Based on the First Past Aeon
Phần giải thích về các luận chấp thường còn của những người chấp về phần quá khứ.
Pubbantakappikasassatavādavaṇṇanā
28. Thus, having extensively explained the three kinds of moral discipline in connection with the praise spoken by Brahmadatta, now, in connection with the praise spoken by the Community of Bhikkhus, he began the exposition of emptiness with the method, "There are, bhikkhus, other things that are deep, difficult to see," and so on. Herein, the word "things" applies in the senses of qualities, teaching, full comprehension, not-a-being, and so forth.
"For Dhamma and Adhamma, both do not have the same result;
Adhamma leads to hell, Dhamma brings one to a good destination." (Theragāthā 304);
28. Như vậy, sau khi giải thích chi tiết ba loại giới theo mạch văn tán thán công đức của Brahmadatta (Phạm-thọ), giờ đây, bắt đầu khai mở về tính không theo mạch văn tán thán công đức của chúng Tỳ-kheo bằng phương pháp "Này các Tỳ-kheo, có những pháp khác thâm sâu, khó thấy," v.v... Ở đây, chữ "pháp" (dhammā) có nghĩa là đức hạnh, giáo pháp, thánh điển, phi hữu tình, v.v...
"Pháp và phi pháp,
Không có quả báo giống nhau;
Phi pháp dẫn đến địa ngục,
Pháp đưa đến thiện thú." (Theragā. 304);
28. Evaṃ brahmadattena vuttavaṇṇassa anusandhivasena tividhaṃ sīlaṃ vitthāretvā idāni bhikkhusaṅghena vuttavaṇṇassa anusandhivasena – ‘‘atthi, bhikkhave, aññeva dhammā gambhīrā duddasā’’tiādinā nayena suññatāpakāsanaṃ ārabhi. Tattha dhammāti guṇe, desanāyaṃ, pariyattiyaṃ, nissatteti evamādīsu dhammasaddo vattati.
‘‘Na hi dhammo adhammo ca, ubho samavipākino;
Adhammo nirayaṃ neti, dhammo pāpeti suggati’’nti. (theragā. 304);
In such instances as these, the word "Dhamma" applies in the sense of qualities. In instances such as "Bhikkhus, I will teach you the Dhamma, good in the beginning" (Majjhima Nikāya 3.420), it applies in the sense of teaching. In instances such as "Here, a bhikkhu fully comprehends the Dhamma: discourse, narrative" (Aṅguttara Nikāya 5.73), it applies in the sense of full comprehension. In instances such as "At that time, there are dhammas, there are aggregates" (Dhammasaṅgaṇī 121), it applies in the sense of not-a-being. Here, however, it applies in the sense of qualities. Therefore, the meaning here should be understood as "There are, bhikkhus, other qualities of the Tathāgata."
Trong những câu trên, chữ "pháp" có nghĩa là đức hạnh. Trong câu "Này các Tỳ-kheo, Ta sẽ thuyết pháp, sơ thiện..." (Majjhima Nikāya 3.420), chữ "pháp" có nghĩa là giáo pháp. Trong câu "Ở đây, Tỳ-kheo học thuộc lòng pháp: kinh, kệ..." (Aṅguttara Nikāya 5.73), chữ "pháp" có nghĩa là thánh điển. Trong câu "Trong thời gian đó, có các pháp, có các uẩn..." (Dhammasaṅgaṇi 121), chữ "pháp" có nghĩa là phi hữu tình. Ở đây, chữ "pháp" có nghĩa là đức hạnh. Vì vậy, ở đây cần hiểu nghĩa là: "Này các Tỳ-kheo, có những đức hạnh khác của Như Lai".
Ādīsu hi guṇe dhammasaddo. ‘‘Dhammaṃ, vo bhikkhave, desessāmi ādikalyāṇa’’ntiādīsu (ma. ni. 3.420) desanāyaṃ. ‘‘Idha bhikkhu dhammaṃ pariyāpuṇāti suttaṃ , geyya’’ntiādīsu (a. ni. 5.73) pariyattiyaṃ. ‘‘Tasmiṃ kho pana samaye dhammā honti, khandhā hontī’’tiādīsu (dha. sa. 121) nissatte. Idha pana guṇe vattati. Tasmā atthi, bhikkhave, aññeva tathāgatassa guṇāti evamettha attho daṭṭhabbo.
"Deep" means like the great ocean, where, except for the Tathāgata with his probe the size of the snout of a *makara* , other's knowledge find no footing to reach with. Because of their very depth, are hard to see. Because of their being hard to see, are difficult to understand. "Peaceful" means that all burning has been quenched. They are peaceful also because they occur with peaceful objects. "Sublime" means that they prevent dissatisfaction, like a meal of delicious taste. "Not to be arrived at by mere reasoning" since it is the object of supreme knowledge. "Subtle," because of their nature as fine and detailed. "To be experienced by the wise," because they are not within the range of fools, but to be experienced by the wise.
Thâm sâu (Gambhīrā) nghĩa là như biển cả mênh mông, ngoài Như Lai ra, không ai có thể dùng trí tuệ của mình đạt đến chỗ đứng vững chắc, ngoại trừ bằng cây kim xỏ lỗ mũi con muỗi (ví dụ về sự không thể), vì thâm sâu nên khó thấy (duddasā). Vì khó thấy nên khó giác ngộ (duranubodhā). Vì đã dập tắt mọi sự thiêu đốt nên tịch tịnh (santā), vì khởi lên trong các đối tượng tịch tịnh nên tịch tịnh. Vì có nghĩa làm cho không nhàm chán nên thù thắng (paṇītā), như món ăn ngon ngọt. Vì là đối tượng của trí tuệ tối thượng nên không thể bị tư duy suy lường xâm chiếm, nghĩa là vượt ngoài tư duy suy lường (atakkāvacarā). Tinh tế (Nipuṇā) nghĩa là vì có bản chất vi tế, सूक्ष्म (sūksma: tế nhị, nhỏ bé, tinh vi). Vì không phải là đối tượng của kẻ ngu si, chỉ có bậc trí tuệ mới có thể hiểu được, nghĩa là bậc trí tuệ liễu tri (paṇḍitavedanīyā).
Gambhīrāti mahāsamuddo viya makasatuṇḍasūciyā aññatra tathāgatā aññesaṃ ñāṇena alabbhaneyyapatiṭṭhā, gambhīrattāyeva duddasā. Duddasattāyeva duranubodhā. Nibbutasabbapariḷāhattā santā, santārammaṇesu pavattanatopi santā. Atittikaraṇaṭṭhena paṇītā, sādurasabhojanaṃ viya. Uttamañāṇavisayattā na takkena avacaritabbāti atakkāvacarā. Nipuṇāti saṇhasukhumasabhāvattā. Bālānaṃ avisayattā, paṇḍitehiyeva veditabbāti paṇḍitavedanīyā.
"Which the Tathāgata, having realized them himself by higher knowledge, proclaims," means those things which the Tathāgata, being independent of others, having himself directly known them by special knowledge, proclaims, illuminates, declares, makes known. "By which" means by which qualities and things. "Would, when speaking rightly, speak" means that those wishing to speak of the praise of the Tathāgata would speak rightly, would be able to speak without omission. And what are those things thus praised by the Blessed One? The knowledge of all-knowingness. If so, why is the plural used? Because of the variety of associated states of consciousness, and because of the variety of objects. For it is found in the four great operative consciousnesses accompanied by knowledge, and there is no thing that is not an object for it. As it is said: "He knows everything past; this is omniscience, in which there is no obstruction; this is unobstructed knowledge." (Paṭisambhidāmagga 1.120). Thus, the plural is used because of the repeated arising of various associated states of consciousness and because of the variety of objects.
Những gì Như Lai tự mình giác ngộ, chứng đạt và tuyên thuyết (Ye tathāgato sayaṃ abhiññā sacchikatvā pavedeti) nghĩa là những pháp mà Như Lai, không bị ai dẫn dắt, tự mình bằng thắng trí, chứng ngộ và tuyên thuyết, chỉ rõ, giảng nói, khai thị. Những gì (Yehī) nghĩa là những đức hạnh. Chân thật (Yathābhuccanti) nghĩa là như thật. Tán thán đúng đắn (Vaṇṇaṃ sammā vadamānā vadeyyunti) nghĩa là những ai muốn tán thán Như Lai thì nên tán thán đúng đắn, không bỏ sót, có thể nói ra. Và những pháp nào được Đức Thế Tôn tán thán như vậy? Đó là Nhất Thiết Chủng Trí (Sabbaññutaññāṇa). Nếu vậy, tại sao lại dùng số nhiều? Vì sự kết hợp với nhiều loại tâm và nhiều đối tượng. Vì trí ấy có được trong bốn tâm đại hành tương ưng trí, và không có pháp nào không phải là đối tượng của trí ấy. Như đã nói – "Biết tất cả quá khứ là Nhất Thiết Chủng Trí, không có chướng ngại ở đó là Vô Chướng Ngại Trí," v.v... (Paṭisambhidāmagga 1.120). Như vậy, vì sự kết hợp với nhiều loại tâm, vì sự sanh khởi liên tục, và vì nhiều đối tượng, nên dùng số nhiều.
Ye tathāgato sayaṃ abhiññā sacchikatvā pavedetīti ye dhamme tathāgato anaññaneyyo hutvā sayameva abhivisiṭṭhena ñāṇena paccakkhaṃ katvā pavedeti, dīpeti, katheti, pakāsetīti attho. Yehīti yehi guṇadhammehi. Yathābhuccanti yathābhūtaṃ. Vaṇṇaṃ sammā vadamānā vadeyyunti tathāgatassa vaṇṇaṃ vattukāmā sammā vadeyyuṃ, ahāpetvā vattuṃ sakkuṇeyyunti attho. Katame ca pana te dhammā bhagavatā evaṃ thomitāti? Sabbaññutaññāṇaṃ. Yadi evaṃ, kasmā bahuvacananiddeso katoti? Puthucittasamāyogato ceva, puthuārammaṇato ca. Tañhi catūsu ñāṇasampayuttamahākiriyacittesu labbhati, na cassa koci dhammo ārammaṇaṃ nāma na hoti. Yathāha – ‘‘atītaṃ sabbaṃ jānātīti sabbaññutaññāṇaṃ, tattha āvaraṇaṃ natthīti anāvaraṇañāṇa’’ntiādi (paṭi. ma. 1.120). Iti puthucittasamāyogato punappunaṃ uppattivasena puthuārammaṇato ca bahuvacananiddeso katoti.
"Other" is here a word of definition, "Other, not abstinences from taking life and so on. Deep, not shallow," thus it should be construed with all the terms. For the knowledge of a disciple's perfections is deep, but the knowledge of an independently enlightened one is deeper than that, in which there is no defining it, and the knowledge of all-knowingness is even deeper than that, in that there is no defining it, beyond this nothing is deeper; therefore definition is found in 'deep'. Similarly, 'hard to see' and 'difficult to understand' should all be understood.
"Khác" (Aññevā) ở đây là từ ngữ phân biệt, "khác, không phải là sự tránh xa sát sanh, v.v... Thật thâm sâu, không phải cạn cợt," như vậy nên kết hợp với tất cả các từ. Trí tuệ của bậc Thanh Văn Bồ-đề thì thâm sâu, trí tuệ của bậc Độc Giác Bồ-đề thì thâm sâu hơn, và Nhất Thiết Chủng Trí thì thâm sâu hơn nữa, ở đó không có sự phân biệt, nhưng không có gì thâm sâu hơn nữa; vì vậy, "thật thâm sâu" là sự phân biệt có được. Cũng vậy, "thật khó thấy, thật khó giác ngộ," cần hiểu tất cả.
‘‘Aññevā’’ti idaṃ panettha vavatthāpanavacanaṃ, ‘‘aññeva, na pāṇātipātā veramaṇiādayo. Gambhīrāva na uttānā’’ti evaṃ sabbapadehi yojetabbaṃ. Sāvakapāramīñāṇañhi gambhīraṃ, paccekabodhiñāṇaṃ pana tato gambhīrataranti tattha vavatthānaṃ natthi, sabbaññutaññāṇañca tatopi gambhīrataranti tatthāpi vavatthānaṃ natthi, ito panaññaṃ gambhīrataraṃ natthi; tasmā gambhīrā vāti vavatthānaṃ labbhati. Tathā duddasāva duranubodhā vāti sabbaṃ veditabbaṃ.
"And what, bhikkhus, are those things" this, however, is question about their desire to be told those things. "There are, bhikkhus, some recluses and brahmins" and so on, is the answer to the question. But why was this thus begun? For, reaching four situations, the Buddhas' roar becomes great, knowledge enters in, the greatness of the Buddha's knowledge becomes evident, the teaching becomes deep, struck by the three characteristics, connected with emptiness. What are the four? The laying down of training rules, the classification of planes, dependent origination, and other systems. Therefore - "This is light, this is heavy, this can be cured, this cannot be cured, this is an offence, this is not an offence, this leads to cutting off, this leads to arising, this leads to expiation, this is blameable by the world, this is blameable by the discipline, in this situation this should be laid down" - what is called the laying down of a training rule in a given situation, therein others have no strength or power; this is not the realm of others, it is the realm of the Tathāgata alone. Thus, reaching the laying down of training rules, the Buddhas' roar becomes great, knowledge enters in... connected with emptiness.
Và này các Tỳ-kheo, những pháp ấy là gì? (Katameca te bhikkhaveti) đây là câu hỏi mong muốn trình bày về những pháp ấy. "Này các Tỳ-kheo, có những Sa-môn, Bà-la-môn" (Santi, bhikkhave, eke samaṇabrāhmaṇāti) v.v... là câu trả lời cho câu hỏi. Tại sao lại bắt đầu như vậy? Vì đối với chư Phật, có bốn trường hợp mà tiếng rống lớn vang lên, trí tuệ thâm nhập, tính vĩ đại của Phật trí được hiển lộ, giáo pháp thâm sâu, bị ba tướng trạng chi phối, liên hệ đến tính không. Bốn trường hợp nào? Chế định giới luật (Vinayapaññatti), phân chia địa giới (bhūmantara), duyên khởi (paccayākāra), và các học thuyết khác (samayantara). Vì vậy – "Cái này nhẹ, cái này nặng, cái này có thể chữa trị, cái này không thể chữa trị, đây là phạm tội, đây là không phạm tội, cái này dẫn đến diệt trừ, cái này dẫn đến xuất ly, cái này dẫn đến thuyết pháp, cái này là lỗi lầm thế gian, cái này là lỗi lầm chế định, trong trường hợp này cần chế định cái này," sự chế định giới luật trong trường hợp đã xảy ra như vậy, ở đó không có sức mạnh hay năng lực của những người khác; đây không phải là đối tượng của những người khác, mà là đối tượng của Như Lai. Như vậy, khi đạt đến sự chế định giới luật, tiếng rống lớn của chư Phật vang lên, trí tuệ thâm nhập... v.v... liên hệ đến tính không.
Katameca te bhikkhaveti ayaṃ pana tesaṃ dhammānaṃ kathetukamyatā pucchā. Santi, bhikkhave, eke samaṇabrāhmaṇātiādi pucchāvissajjanaṃ. Kasmā panetaṃ evaṃ āraddhanti ce? Buddhānañhi cattāri ṭhānāni patvā gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati, buddhañāṇassa mahantabhāvo paññāyati, desanā gambhīrā hoti, tilakkhaṇāhatā, suññatāpaṭisaṃyuttā. Katamāni cattāri? Vinayapaññattiṃ, bhūmantaraṃ, paccayākāraṃ, samayantaranti. Tasmā – ‘‘idaṃ lahukaṃ, idaṃ garukaṃ, idaṃ satekicchaṃ, idaṃ atekicchaṃ, ayaṃ āpatti, ayaṃ anāpatti, ayaṃ chejjagāminī, ayaṃ vuṭṭhānagāminī, ayaṃ desanāgāminī, ayaṃ lokavajjā, ayaṃ paṇṇattivajjā, imasmiṃ vatthusmiṃ idaṃ paññapetabba’’nti yaṃ evaṃ otiṇṇe vatthusmiṃ sikkhāpadapaññāpanaṃ nāma, tattha aññesaṃ thāmo vā balaṃ vā natthi; avisayo esa aññesaṃ, tathāgatasseva visayo. Iti vinayapaññattiṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Similarly, these four foundations of mindfulness… the Noble Eightfold Path… the five aggregates… the twelve sense-bases… the eighteen elements… the Four Noble Truths… the twenty-two faculties… the nine causes… the four nutriments… the seven kinds of contact… the seven kinds of feeling… the seven kinds of perception… the seven kinds of volition… the seven kinds of consciousness. Among these, so many things belong to the sense-sphere, so many things belong to the fine-material and immaterial spheres, so many things are mundane, so many things are supramundane - to divide and expound the Abhidhamma Piṭaka, the limitless method of the twenty-four universal conditions, others have no strength or power; this is not the realm of others, it is the realm of the Tathāgata alone. Thus, reaching the classification of planes, the Buddhas' roar becomes great, knowledge enters in… connected with emptiness.
Cũng vậy, bốn Niệm Xứ này... v.v... Thánh Đạo Tám Ngành này, năm uẩn này, mười hai xứ này, mười tám giới này, bốn Thánh Đế này, hai mươi hai căn này, chín nhân này, bốn loại thức ăn này, bảy xúc này, bảy thọ này, bảy tưởng này, bảy tư này, bảy thức này. Trong những pháp này, có chừng này pháp thuộc Dục giới, có chừng này pháp thuộc Sắc giới và Vô Sắc giới, có chừng này pháp thuộc thế gian, có chừng này pháp thuộc xuất thế gian – hai mươi bốn phương diện của Vô Ngại Giải Thoát Đạo (catuvīsatisamantapaṭṭhānaṃ), vô lượng phương pháp của Tạng Vi Diệu Pháp (abhidhammapiṭakaṃ), phân chia và trình bày, ở đó không có sức mạnh hay năng lực của những người khác; đây không phải là đối tượng của những người khác, mà là đối tượng của Như Lai. Như vậy, khi đạt đến sự phân chia địa giới, tiếng rống lớn của chư Phật vang lên, trí tuệ thâm nhập... v.v... liên hệ đến tính không.
Tathā ime cattāro satipaṭṭhānā nāma…pe… ariyo aṭṭhaṅgiko maggo nāma, pañca khandhā nāma, dvādasa āyatanāni nāma, aṭṭhārasa dhātuyo nāma, cattāri ariyasaccāni nāma, bāvīsatindriyāni nāma, nava hetū nāma, cattāro āhārā nāma, satta phassā nāma, satta vedanā nāma, satta saññā nāma, satta cetanā nāma, satta cittāni nāma. Etesu ettakā kāmāvacarā dhammā nāma, ettakā rūpāvacaraarūpāvacarapariyāpannā dhammā nāma, ettakā lokiyā dhammā nāma, ettakā lokuttarā dhammā nāmāti catuvīsatisamantapaṭṭhānaṃ anantanayaṃ abhidhammapiṭakaṃ vibhajitvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo. Iti bhūmantaraparicchedaṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Similarly, this ignorance is a condition for formations in nine ways, being a condition as arising, being a condition as continuity, as sign, as accumulation, as connection, as obstruction, as origination, as cause, as condition, thus formations and so on are conditions for consciousness and so on. As it is said: "How is understanding in grasping conditions knowledge of the stability of things? Ignorance has arising-stability and continuity-stability, and sign-stability, and accumulation-stability, and connection-stability, and obstruction-stability, and origination-stability, and cause-stability, and condition-stability for formations. In these nine ways, ignorance is the condition, formations are conditionally arisen, both these things are conditionally arisen - understanding in grasping conditions is knowledge of the stability of things. In the past period too, in the future period too, ignorance has arising-stability… birth has arising-stability… condition-stability for old age and death. In these nine ways, birth is the condition, old age and death are conditionally arisen, both these things are conditionally arisen - understanding in grasping conditions is knowledge of the stability of things." (Paṭisambhidāmagga 1.45). Thus, to divide and expound this dependent origination with its three rounds, three periods, three connections, four sections, and twenty aspects, occurring as a condition in this and that way for this and that thing, others have no strength or power; this is not the realm of others, it is the realm of the Tathāgata alone. Thus, reaching dependent origination, the Buddhas' roar becomes great, knowledge enters in… connected with emptiness.
Cũng vậy, vô minh này là duyên cho các hành theo chín cách, là duyên vì là sự sanh khởi, là duyên vì là sự diễn tiến, là duyên vì là tướng, là duyên vì là sự tích tập, là duyên vì là sự kết hợp, là duyên vì là sự chướng ngại, là duyên vì là sự tập khởi, là duyên vì là nhân, là duyên vì là duyên, cũng vậy các hành, v.v... là duyên cho thức, v.v... Như đã nói – "Làm thế nào trí về sự nắm giữ duyên là pháp trú trí? Vô minh là sự sanh khởi, sự tồn tại, sự diễn tiến, tướng, sự tích tập, sự kết hợp, sự chướng ngại, sự tập khởi, nhân, và duyên của các hành, theo chín cách này vô minh là duyên, các hành là do duyên sanh khởi, cả hai pháp này đều do duyên sanh khởi, trí về sự nắm giữ duyên là pháp trú trí. Trong quá khứ, trong tương lai, vô minh là sự sanh khởi... v.v... của các hành, sanh là sự sanh khởi... v.v... duyên của già chết, theo chín cách này sanh là duyên, già chết là do duyên sanh khởi, cả hai pháp này đều do duyên sanh khởi, trí về sự nắm giữ duyên là pháp trú trí" (Paṭisambhidāmagga 1.45). Như vậy, Duyên Khởi (paṭiccasamuppāda) này diễn tiến theo ba luân hồi, ba thời, ba nối kết, bốn tóm lược, hai mươi hình thái, bằng cách là duyên như vậy như vậy cho pháp kia, phân chia và trình bày, ở đó không có sức mạnh hay năng lực của những người khác; đây không phải là đối tượng của những người khác, mà là đối tượng của Như Lai, như vậy khi đạt đến duyên khởi, tiếng rống lớn của chư Phật vang lên, trí tuệ thâm nhập... v.v... liên hệ đến tính không.
Tathā ayaṃ avijjā saṅkhārānaṃ navahākārehi paccayo hoti, uppādo hutvā paccayo hoti, pavattaṃ hutvā, nimittaṃ, āyūhanaṃ, saṃyogo, palibodho, samudayo, hetu, paccayo hutvā paccayo hoti, tathā saṅkhārādayo viññāṇādīnaṃ. Yathāha – ‘‘kathaṃ paccayapariggahe paññā dhammaṭṭhitiñāṇaṃ? Avijjā saṅkhārānaṃ uppādaṭṭhiti ca pavattaṭṭhiti ca, nimittaṭṭhiti ca, āyūhanaṭṭhiti ca, saṃyogaṭṭhiti ca, palibodhaṭṭhiti ca, samudayaṭṭhiti ca, hetuṭṭhiti ca, paccayaṭṭhiti ca, imehi navahākārehi avijjā paccayo, saṅkhārā paccayasamuppannā, ubhopete dhammā paccayasamuppannāti paccayapariggahe paññā dhammaṭṭhitiñāṇaṃ. Atītampi addhānaṃ, anāgatampi addhānaṃ avijjā saṅkhārānaṃ uppādaṭṭhiti ca…pe… jāti jarāmaraṇassa uppādaṭṭhiti ca…pe… paccayaṭṭhiti ca, imehi navahākārehi jāti paccayo, jarāmaraṇaṃ paccayasamuppannaṃ, ubhopete dhammā paccayasamuppannāti paccayapariggahe paññā dhammaṭṭhitiñāṇa’’nti (paṭi. ma. 1.45). Evamimaṃ tassa tassa dhammassa tathā tathā paccayabhāvena pavattaṃ tivaṭṭaṃ tiyaddhaṃ tisandhiṃ catusaṅkhepaṃ vīsatākāraṃ paṭiccasamuppādaṃ vibhajitvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo, iti paccayākāraṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati…pe… suññatāpaṭisaṃyuttāti.
Similarly, four people are eternalists, four are partial-eternalists, four are extensionists, four are wrigglers, two are fortuitous-originationists, sixteen are perceptionists, eight are non-perceptionists, eight are neither-perception-nor-non-perceptionists, seven are annihilationists, five are Nibbāna-in-this-life-ists. Refuting the sixty-two views, saying "They rely on this, they grasp this," making them empty and devoid, others have no strength or power; this is not the realm of others, it is the realm of the Tathāgata alone. Thus, reaching other systems, the Buddhas' roar becomes great, knowledge enters in, the greatness of the Buddha's knowledge becomes evident, the teaching becomes deep, struck by the three characteristics, connected with emptiness.
Cũng vậy, có bốn hạng người theo Thường Kiến (sassatavādā), bốn hạng người theo Nhất Phần Thường Kiến (ekaccasassatavādā), bốn hạng người theo Hữu Biên Vô Biên Luận (antānantikā), bốn hạng người theo Ngụy Biện Bất Tử Luận (amarāvikkhepikā), hai hạng người theo Vô Nhân Sanh Luận (adhiccasamuppannikā), mười sáu hạng người theo Hữu Tưởng Luận (saññīvādā), tám hạng người theo Vô Tưởng Luận (asaññīvādā), tám hạng người theo Phi Tưởng Phi Phi Tưởng Luận (nevasaññīnāsaññīvādā), bảy hạng người theo Đoạn Kiến (ucchedavādā), năm hạng người theo Hiện Pháp Niết-bàn Luận (diṭṭhadhammanibbānavādā). Dựa vào cái này, chấp trước cái này, phá vỡ sáu mươi hai tà kiến, làm cho trống rỗng, không còn rối rắm, trình bày, ở đó không có sức mạnh hay năng lực của những người khác; đây không phải là đối tượng của những người khác, mà là đối tượng của Như Lai. Như vậy, khi đạt đến các học thuyết khác, tiếng rống lớn của chư Phật vang lên, trí tuệ thâm nhập, tính vĩ đại của Phật trí được hiển lộ, giáo pháp thâm sâu, bị ba tướng trạng chi phối, liên hệ đến tính không.
Tathā cattāro janā sassatavādā nāma, cattāro ekaccasassatavādā, cattāro antānantikā, cattāro amarāvikkhepikā, dve adhiccasamuppannikā, soḷasa saññīvādā, aṭṭha asaññīvādā, aṭṭha nevasaññīnāsaññīvādā, satta ucchedavādā, pañca diṭṭhadhammanibbānavādā nāma. Te idaṃ nissāya idaṃ gaṇhantīti dvāsaṭṭhi diṭṭhigatāni bhinditvā nijjaṭaṃ niggumbaṃ katvā kathetuṃ aññesaṃ thāmo vā balaṃ vā natthi, avisayo esa aññesaṃ, tathāgatasseva visayo. Iti samayantaraṃ patvā buddhānaṃ gajjitaṃ mahantaṃ hoti, ñāṇaṃ anupavisati, buddhañāṇassa mahantatā paññāyati, desanā gambhīrā hoti, tilakkhaṇāhatā, suññatāpaṭisaṃyuttāti.
But in this situation, other systems are obtained, therefore to show the greatness of the knowledge of all-knowingness, and to explain the exposition of emptiness in the teaching, entering into other systems, the Dhamma King began the answer to the question thus: "There are, bhikkhus, some recluses and brahmins".
Ở trường hợp này, có được các học thuyết khác, vì vậy, để chỉ rõ tính vĩ đại của Nhất Thiết Chủng Trí và làm sáng tỏ tính không của giáo pháp, Đức Pháp Vương, thâm nhập vào các học thuyết khác, đã bắt đầu câu trả lời cho câu hỏi bằng câu "Này các Tỳ-kheo, có những Sa-môn, Bà-la-môn" (Santi, bhikkhave, eke samaṇabrāhmaṇā).
Imasmiṃ pana ṭhāne samayantaraṃ labbhati, tasmā sabbaññutaññāṇassa mahantabhāvadassanatthaṃ desanāya ca suññatāpakāsanavibhāvanatthaṃ samayantaraṃ anupavisanto dhammarājā – ‘‘santi, bhikkhave, eke samaṇabrāhmaṇā’’ti evaṃ pucchāvissajjanaṃ ārabhi.
29. Herein, "are" means exist, are found, are obtained. "Monks" is a vocative expression. "Some" means certain ones. "Ascetics and Brahmins" means ascetics through undertaking the homeless life, and Brahmins by birth. Or, those who are regarded by the world as "ascetics" and as "Brahmins." Those who speculate and ponder, grasping at the former end, are "speculators about the former end." Or, those who have a former end are "speculators about the former end." Herein, this word "end" is seen in the meanings of end, interior, limit, worst part, and portion. For in such instances as "end-full, full of the belly", "end" refers to the end. In such instances as "They wander in the world surrounded by a retinue, internally impure, outwardly appearing beautiful", it refers to the interior. "The end of the binding of the body wears out." "She is either green-ended, or road-ended, or mountain-ended, or water-ended", in these, it refers to a limit. "This, monks, is the worst end of livelihoods, that is, alms-begging", in these, it refers to the worst part. In such instances as "This is the ultimate end of suffering", it refers to the further part. For the destruction of all conditions is called the further part, the limit, of suffering. In such instances as "Personality-view, friend, is one end", it refers to a portion. Here, it also refers to a portion.
29. Trong đó, "có" (santīti) nghĩa là tồn tại, hiện hữu, được tìm thấy. "Này các Tỷ-kheo" (Bhikkhaveti) là lời gọi. "Một số" (Eketi) nghĩa là một vài. "Sa-môn và Bà-la-môn" (Samaṇabrāhmaṇāti) là những người Sa-môn do đã chấp nhận đời sống xuất gia, và những người Bà-la-môn do dòng dõi. Hoặc những người được thế gian công nhận là Sa-môn và Bà-la-môn. Những người suy tư, suy đoán về quá khứ được gọi là "những người suy tư về quá khứ" (pubbantakappikā). Hoặc, những người có quan điểm về quá khứ (pubbantakappo) được gọi là "những người suy tư về quá khứ" (pubbantakappikā). Trong đó, chữ "giới hạn" (anta) này có thể thấy trong các nghĩa như: giới hạn, bên trong, ranh giới, xấu xa, phần còn lại, phần. Trong các câu như: "đầy bụng" (antapūro udarapūro), ở đây, chữ "giới hạn" (anta) có nghĩa là "giới hạn". Trong các câu (saṃ. ni. 1.122) như: "Họ đi lại trong thế gian được che đậy bởi đồ trang sức, bên trong (anto) thì bất tịnh, bên ngoài thì xinh đẹp", có nghĩa là "bên trong". Trong câu "phần bên trong (anto) của dây lưng bị mục" (cūḷava. 278). Trong các câu (ma. ni. 1.304) như: "hoặc đám cỏ xanh rì, hoặc bìa rừng, hoặc núi, hoặc nước", có nghĩa là "ranh giới". Trong các câu (saṃ. ni. 3.80) như: "Này các Tỷ-kheo, đây là sự sống hèn hạ (anta), đó là khất thực", có nghĩa là "xấu xa". Trong các câu (saṃ. ni. 2.51) như: "Đây là phần còn lại (anto) của khổ", có nghĩa là "phần còn lại". Sự đoạn diệt tất cả các duyên được gọi là phần còn lại, phần cuối cùng của khổ. Trong các câu (a. ni. 6.61) như: "Này các đạo hữu, thân kiến là một phần (anto)", có nghĩa là "phần". Ở đây (trong ngữ cảnh này) từ này cũng có nghĩa là "phần".
29. Tattha santīti atthi saṃvijjanti upalabbhanti. Bhikkhaveti ālapanavacanaṃ. Eketi ekacce. Samaṇabrāhmaṇāti pabbajjūpagatabhāvena samaṇā, jātiyā brāhmaṇā. Lokena vā samaṇāti ca brāhmaṇāti ca evaṃ sammatā. Pubbantaṃ kappetvā vikappetvā gaṇhantīti pubbantakappikā. Pubbantakappo vā etesaṃ atthīti pubbantakappikā. Tattha antoti ayaṃ saddo antaabbhantaramariyādalāmakaparabhāgakoṭṭhāsesu dissati. ‘‘Antapūro udarapūro’’tiādīsu hi ante antasaddo. ‘‘Caranti loke parivārachannā anto asuddhā bahi sobhamānā’’tiādīsu (saṃ. ni. 1.122) abbhantare. ‘‘Kāyabandhanassa anto jīrati (cūḷava. 278). ‘‘Sā haritantaṃ vā panthantaṃ vā selantaṃ vā udakantaṃ vā’’tiādīsu (ma. ni. 1.304) mariyādāyaṃ. ‘‘Antamidaṃ, bhikkhave, jīvikānaṃ yadidaṃ piṇḍolya’’ntiādīsu (saṃ. ni. 3.80) lāmake. ‘‘Esevanto dukkhassā’’tiādīsu (saṃ. ni. 2.51) parabhāge. Sabbapaccayasaṅkhayo hi dukkhassa parabhāgo koṭīti vuccati. ‘‘Sakkāyo kho, āvuso, eko anto’’tiādīsu (a. ni. 6.61) koṭṭhāse. Svāyaṃ idhāpi koṭṭhāse vattati.
The word "Kappa" also – "Let the Blessed One remain, O Lord, for an aeon", "There is an aeon to lie down", "The well-prepared is sewn with the unprepared", thus it occurs in many meanings such as life-aeon, moment-aeon, discipline-aeon, and so on. Here it should be understood as referring to craving and views. It has also been said: "Aeons are two aeons, the aeon of craving and the aeon of views". Therefore, having speculated and extensively speculated on the past portion of existences by way of craving and views, they remain established – thus they are "speculators about the former end" – in this way the meaning should be understood here. The views of those who are thus established, speculating about the former end, following only the former end, are due to arising again and again; thus they are "those with views following the former end". Having taken up that former end, having approached it, depending upon it, making other people adhere to views, they proclaim various positions of adherence, with eighteen grounds.
Chữ "kiếp" (kappa) – trong các câu như (dī. ni. 2.167): "Bạch Thế Tôn, xin Thế Tôn hãy trụ thế thêm một kiếp (kappaṃ)", "có đủ (kappo) để nằm xuống" (a. ni. 8.80), "cái không hợp lẽ đã được may lại bằng cái hợp lẽ" (pāci. 371), có thể thấy trong nhiều nghĩa như: thời gian của một kiếp (āyukappa), một phần nhỏ của kiếp (lesakappa), giới luật (vinayakappa) và v.v... Ở đây, cần phải hiểu nó có nghĩa là "trong các tham ái và tà kiến". Như đã nói: "Có hai loại kiếp, tham ái kiếp (taṇhākappo) và tà kiến kiếp (diṭṭhikappo)" (mahāni. 28). Vì vậy, cần phải hiểu ở đây, nghĩa là, những người thiết lập, sắp đặt phần quá khứ bằng tham ái và tà kiến thì được gọi là những người suy tư về quá khứ (pubbantakappikā). Những tà kiến của họ bám theo quá khứ, do sự sinh khởi lặp đi lặp lại của việc thiết lập quá khứ như vậy, được gọi là "những người có tà kiến hướng về quá khứ" (pubbantānudiṭṭhino). Những người có tà kiến như vậy, y cứ vào, nương tựa vào, chấp trước vào quá khứ đó, làm cho người khác cũng trở thành tà kiến, tuyên bố nhiều loại kiến chấp khác nhau bằng mười tám sự việc.
Kappasaddopi – ‘‘tiṭṭhatu, bhante bhagavā kappaṃ’’ (dī. ni. 2.167), ‘‘atthi kappo nipajjituṃ’’ (a. ni. 8.80), ‘‘kappakatena akappakataṃ saṃsibbitaṃ hotī’’ti, (pāci. 371) evaṃ āyukappalesakappavinayakappādīsu sambahulesu atthesu vattati. Idha taṇhādiṭṭhīsu vattatīti veditabbo. Vuttampi cetaṃ – ‘‘kappāti dve kappā, taṇhākappo ca diṭṭhikappo cā’’ti (mahāni. 28). Tasmā taṇhādiṭṭhivasena atītaṃ khandhakoṭṭhāsaṃ kappetvā pakappetvā ṭhitāti pubbantakappikāti evamettha attho veditabbo. Tesaṃ evaṃ pubbantaṃ kappetvā ṭhitānaṃ punappunaṃ uppajjanavasena pubbantameva anugatā diṭṭhīti pubbantānudiṭṭhino. Te evaṃdiṭṭhino taṃ pubbantaṃ ārabbha āgamma paṭicca aññampi janaṃ diṭṭhigatikaṃ karontā anekavihitāni adhimuttipadāni abhivadanti aṭṭhārasahi vatthūhi.
Therein, "various" means of many kinds. "Positions of adherence" are positions of pronouncement. Or, overpowering the real meaning, not grasping it according to its true nature, views are called "adherences" because of their prevalence. The positions of adherences are "positions of adherence," meaning words that illuminate views. "With eighteen grounds" means with eighteen reasons.
Trong đó, "nhiều loại khác nhau" (anekavihitānīti) nghĩa là nhiều hình thức khác nhau. "Kiến chấp" (Adhimuttipadānīti) nghĩa là các lời nói, các thuật ngữ. Hoặc, tà kiến được gọi là "kiến chấp" (adhimuttiyo) vì chúng vượt qua sự thật, không nắm bắt theo đúng thực tại. Những lời nói về kiến chấp (adhimuttīnaṃ padāni), những lời nói làm sáng tỏ tà kiến, được gọi là "kiến chấp" (adhimuttipadāni). "Bằng mười tám sự việc" (Aṭṭhārasahi vatthūhīti) nghĩa là bằng mười tám lý do.
Tattha anekavihitānīti anekavidhāni. Adhimuttipadānīti adhivacanapadāni. Atha vā bhūtaṃ atthaṃ abhibhavitvā yathāsabhāvato aggahetvā pavattanato adhimuttiyoti diṭṭhiyo vuccanti. Adhimuttīnaṃ padāni adhimuttipadāni, diṭṭhidīpakāni vacanānīti attho. Aṭṭhārasahi vatthūhīti aṭṭhārasahi kāraṇehi.
30. Now, wishing to state those eighteen grounds with which they proclaim, he asks with the method beginning with "And those venerable ones…", and, having divided those grounds, he says, beginning with "There are, monks…". Therein, that by which they speak is a view, this is a designation for holding to a view. Those whose view is that it is eternal are "eternalists," meaning those with the view of eternity. In the same way, the meaning of similar words from here onwards should be understood. They proclaim the self and the world to be eternal, having taken something among form and so on as "self" and as "world," and they proclaim that to be eternal, immortal, permanent, everlasting. As he says: "They proclaim form to be the self and the world, and that to be eternal; likewise, they proclaim feeling, perception, formations, consciousness to be the self and the world, and that to be eternal."
30. Bây giờ, để trả lời câu hỏi về mười tám sự việc mà họ tuyên bố, sau khi hỏi theo cách thức "Và này các Tôn giả" (te ca kho bhonto) v.v..., để chỉ ra sự phân chia các sự việc đó, Đức Phật nói "Có những vị, này các Tỷ-kheo" (santi, bhikkhave) v.v... Trong đó, "quan điểm" (vāda) là do cái này mà nói ra, đây là một thuật ngữ chỉ cho tà kiến. Những người có quan điểm thường hằng được gọi là "những người chủ trương thường kiến" (sassatavādā), nghĩa là những người có tà kiến thường hằng. Theo cách này, cần phải hiểu nghĩa của các từ tương tự khác. Họ chấp thủ "thường hằng, tự ngã và thế giới" (Sassataṃ attānañca lokañcāti), chấp thủ một trong các sắc, v.v..., cho đó là tự ngã và thế giới, rồi tuyên bố nó là thường hằng, bất tử, vĩnh cửu, thường trụ. Như đã nói: "Sắc là tự ngã và thế giới, và là thường hằng", họ tuyên bố như vậy về tự ngã và thế giới; tương tự như vậy, "thọ, tưởng, các hành, thức là tự ngã và thế giới, và là thường hằng", họ tuyên bố như vậy về tự ngã và thế giới.
30. Idāni yehi aṭṭhārasahi vatthūhi abhivadanti, tesaṃ kathetukamyatāya pucchāya ‘‘te ca kho bhonto’’tiādinā nayena pucchitvā tāni vatthūni vibhajitvā dassetuṃ ‘‘santi, bhikkhave’’tiādimāha. Tattha vadanti etenāti vādo, diṭṭhigatassetaṃ adhivacanaṃ. Sassato vādo etesanti sassatavādā, sassatadiṭṭhinoti attho. Eteneva nayena ito paresampi evarūpānaṃ padānaṃ attho veditabbo. Sassataṃ attānañca lokañcāti rūpādīsu aññataraṃ attāti ca lokoti ca gahetvā taṃ sassataṃ amaraṃ niccaṃ dhuvaṃ paññapenti. Yathāha – ‘‘rūpaṃ attā ceva loko ca sassato cāti attānañca lokañca paññapenti tathā vedanaṃ, saññaṃ, saṅkhāre, viññāṇaṃ attā ceva loko ca sassato cāti attānañca lokañca paññapentī’’ti.
31. In "Having attained strenuous effort" and so on, "strenuous effort" is said because of the effort’s being a burning up of defilements. That very same thing is "exertion" because of the way of striving. "Application" is because of repeated engagement. Thus, having attained, having reached, having relied upon effort which is threefold in this way, is the meaning. "Non-distraction" is said to be the non-wandering of mindfulness. "Proper attention" is attention to the means, attention to the path, knowledge of the meaning, is what is meant. Here, the attention is meant as that attention in which one is established and the knowledge of recollection of past lives arises, this is the meaning in this place. Therefore, having attained effort, mindfulness, and knowledge, is the meaning in brief here. "Of such kind" means of such a nature. "Concentration of mind" means concentration of thought. "Touches" means experiences, obtains. "With a mind thus concentrated" – by that concentration with which, when the mind is rightly concentrated, well established, the meaning of "various previous existences" and so on is stated in the *Visuddhimagga*.
31."Nhờ sự tinh tấn" (Ātappamanvāyātiādīsu), tinh tấn (vīriyaṃ) được gọi là "sự tinh tấn" (ātappa) vì nó có khả năng thiêu đốt các phiền não. Cũng chính tinh tấn đó, do sự nỗ lực, được gọi là "sự tinh cần" (padhānaṃ). Do sự liên tục thực hành, nó được gọi là "sự chuyên cần" (anuyogoti). Như vậy, ba loại tinh tấn này, có nghĩa là nương vào, y cứ vào. Bất phóng dật (appamādo) được gọi là sự không rời xa chánh niệm. "Như lý tác ý" (Sammā manasikāroti) nghĩa là sự tác ý khéo léo, sự tác ý đúng đắn, tức là trí tuệ về thực tại. Sự tác ý mà nhờ đó trí tuệ nhớ lại các đời sống quá khứ được thành tựu, thì sự tác ý đó được xem là ý nghĩa trong trường hợp này. Vì vậy, ý nghĩa tóm tắt ở đây là: nương vào tinh tấn, chánh niệm và trí tuệ. "Thích hợp" (Tathārūpanti) nghĩa là có tính chất như vậy. "Định tâm" (Cetosamādhinti) nghĩa là sự định tâm. "Đạt được" (Phusatīti) nghĩa là chứng được, đạt được. "Với tâm định tĩnh như vậy" (Yathā samāhite citteti) nghĩa là với tâm được an trú vững chắc, khéo an trú nhờ định đó, ý nghĩa của các câu như: "nhiều đời sống quá khứ khác nhau" (anekavihitaṃpubbenivāsantiādīnaṃ) được nói trong Thanh Tịnh Đạo (Visuddhimagge).
31.Ātappamanvāyātiādīsu vīriyaṃ kilesānaṃ ātāpanabhāvena ātappanti vuttaṃ. Tadeva padahanavasena padhānaṃ. Punappunaṃ yuttavasena anuyogoti. Evaṃ tippabhedaṃ vīriyaṃ anvāya āgamma paṭiccāti attho. Appamādo vuccati satiyā avippavāso. Sammā manasikāroti upāyamanasikāro, pathamanasikāro, atthato ñāṇanti vuttaṃ hoti. Yasmiñhi manasikāre ṭhitassa pubbenivāsānussati ñāṇaṃ ijjhati, ayaṃ imasmiṃ ṭhāne manasikāroti adhippeto. Tasmā vīriyañca satiñca ñāṇañca āgammāti ayamettha saṅkhepattho. Tathārūpanti tathājātikaṃ. Cetosamādhinti cittasamādhiṃ. Phusatīti vindati paṭilabhati. Yathā samāhite citteti yena samādhinā sammā āhite suṭṭhu ṭhapite cittamhi anekavihitaṃpubbenivāsantiādīnaṃ attho visuddhimagge vutto.
He says thus: Having become endowed with the power of that absorption, he, adhering to the view, says thus. "Barren" means unfruitful, like a barren woman, a barren palmyra palm, and so on, not producing anything. By this, he denies the capacity of form and so on, which are taken as "self" and "world," to produce absorptions and so on. "Established like a mountain peak" means firmly fixed. "Established like a firm post" means standing like a firm post. Just as a firmly planted boundary post stands unshakable, so it stands, is the meaning. By both, he shows the non-destruction of the world. Some, however, say the text reads "established like a soft rush," meaning standing like a soft rush in a marsh. The meaning there is this: What is called "arising" emerges as something already existing, like a soft rush from a marsh. Because it is established like a firm post, therefore those beings wander on, meaning they go elsewhere.
"Vị ấy nói như vậy" (So evamāhāti) nghĩa là vị ấy, sau khi đạt được sức mạnh của thiền định, trở thành tà kiến và nói như vậy. "Vô sinh" (Vañjhoti) nghĩa là không có kết quả, không sinh ra bất cứ thứ gì, giống như những con vật vô sinh, cây thốt nốt vô sinh, v.v... Bằng cách này, vị ấy bác bỏ khả năng sinh ra sắc, v.v..., của thiền định, v.v..., mà được chấp thủ là "tự ngã" và "thế giới". "Như đỉnh núi" (Pabbatakūṭaṃ viya ṭhitoti) nghĩa là "trụ vững như đỉnh núi" (kūṭaṭṭho). "Trụ vững như cột trụ" (Esikaṭṭhāyiṭṭhitoti) nghĩa là "trụ vững như cột trụ bằng đá" (esikaṭṭhāyī). Giống như cột trụ bằng đá được chôn chặt đứng vững không lay động, có nghĩa là đứng vững như vậy. Bằng cả hai cách, vị ấy cho thấy sự không hoại diệt của thế giới. Tuy nhiên, một số người đọc là "īsikaṭṭhāyiṭṭhitoti" và nói rằng nó có nghĩa là "trụ vững như cây lau trên cỏ tranh". Ý nghĩa của nó là: cái được gọi là "sinh ra" (jāyatīti) này, giống như cây lau (īsika) mọc ra từ cỏ tranh (muñja), là cái đã có sẵn. Và vì nó "trụ vững như cây lau" (īsikaṭṭhāyiṭṭhito), nên những chúng sinh đó "luân hồi" (sandhāvanti), nghĩa là đi đến nơi khác.
So evamāhāti so evaṃ jhānānubhāvasampanno hutvā diṭṭhigatiko evaṃ vadati. Vañjhoti vañjhapasuvañjhatālādayo viya aphalo kassaci ajanakoti. Etena ‘‘attā’’ti ca ‘‘loko’’ti ca gahitānaṃ jhānādīnaṃ rūpādijanakabhāvaṃ paṭikkhipati. Pabbatakūṭaṃ viya ṭhitoti kūṭaṭṭho. Esikaṭṭhāyiṭṭhitoti esikaṭṭhāyī viya hutvā ṭhitoti esikaṭṭhāyiṭṭhito. Yathā sunikhāto esikatthambho niccalo tiṭṭhati, evaṃ ṭhitoti attho. Ubhayenapi lokassa vināsābhāvaṃ dīpeti. Keci pana īsikaṭṭhāyiṭṭhitoti pāḷiṃ vatvā muñje īsikā viya ṭhitoti vadanti . Tatrāyamadhippāyo – yadidaṃ jāyatīti vuccati, taṃ muñjato īsikā viya vijjamānameva nikkhamati. Yasmā ca īsikaṭṭhāyiṭṭhito, tasmā teva sattā sandhāvanti, ito aññattha gacchantīti attho.
They transmigrate means they travel on from one to another. They pass away means they reach an end. Likewise, they are reborn. In the Commentary, however, having first said "the self and the world are eternal," now, with the statement "and those beings wander on" and so on, this view-holder breaks his own statement with his own view, the view of a view-holder is not fixed, it is unstable like a peg driven into a heap of chaff, even here, like dung, excrement and so on in a madman's basket, even what is beautiful becomes unbeautiful. "They surely exist, equivalent to the eternal" – here "eternal" means permanent, existing like the great earth, likewise the Sineru mountain, the moon and the sun. Then, considering themselves to be equal to them, they say, "They surely exist, equivalent to the eternal."
"Lưu chuyển" (Saṃsarantīti) nghĩa là đi lại từ chỗ này đến chỗ khác. "Chết" (Cavantīti) nghĩa là đi đến số lượng như vậy. "Tái sinh cũng như vậy" (Tathā upapajjantīti). Tuy nhiên, trong A-tì-đạt-ma (Aṭṭhakathāyaṃ), sau khi nói trước đó rằng "thường hằng, tự ngã và thế giới" (sassato attā ca loko cāti), bây giờ, với câu nói "những chúng sinh đó luân hồi" (te ca sattā sandhāvantītiādinā), người có tà kiến này tự mâu thuẫn với quan điểm của mình. Quan điểm của người có tà kiến không cố định, nó dao động giống như cái cọc chôn trên đống trấu, giống như những thứ đẹp đẽ và không đẹp đẽ như phân bò khô trong túi của người điên, dù đẹp đẽ cũng trở nên không đẹp đẽ. "Thực sự tồn tại ngang bằng với thường hằng" (Atthitveva sassatisamanti), ở đây, "thường hằng" (sassatīti) nghĩa là vĩnh cửu, được hiểu như trái đất rộng lớn, và cũng như núi Tu-di, mặt trăng và mặt trời. Do đó, tự xem mình ngang bằng với chúng, họ nói "thực sự tồn tại ngang bằng với thường hằng".
Saṃsarantīti aparāparaṃ sañcaranti. Cavantīti evaṃ saṅkhyaṃ gacchanti. Tathā upapajjantīti. Aṭṭhakathāyaṃ pana pubbe ‘‘sassato attā ca loko cā’’ti vatvā idāni te ca sattā sandhāvantītiādinā vacanena ayaṃ diṭṭhigatiko attanāyeva attano vādaṃ bhindati, diṭṭhigatikassa dassanaṃ nāma na nibaddhaṃ, thusarāsimhi nikhātakhāṇu viya cañcalaṃ, ummattakapacchiyaṃ pūvakhaṇḍagūthagomayādīni viya cettha sundarampi asundarampi hoti yevāti vuttaṃ. Atthitveva sassatisamanti ettha sassatīti niccaṃ vijjamānatāya mahāpathaviṃva maññati, tathā sinerupabbatacandimasūriye. Tato tehi samaṃ attānaṃ maññamānā atthi tveva sassatisamanti vadanti.
Now, showing the reason for the assertion beginning with "the self and the world are eternal" and so on, he says beginning with "For what reason? I, having attained strenuous effort…". Therein, "I know this" – by this special attainment I know this directly, I do not speak merely out of faith alone, he shows. The syllable "m" is spoken here to make the connection of the words. "This, monks, is the first case" – among the four cases mentioned with the word "case," this is the first case, this recollection of as many as a hundred thousand births is the first reason, is the meaning.
Bây giờ, để đưa ra lý do cho lời khẳng định "thường hằng, tự ngã và thế giới" (sassato attā ca loko cātiādikāya), vị ấy nói "Vì sao như vậy? Vì ta nhờ sự tinh tấn" (taṃ kissa hetu? Ahañhi ātappamanvāyā) v.v... Ở đây, "ta biết điều này" (imināmahaṃ etaṃ jānāmīti), bằng sự chứng đắc đặc biệt này, vị ấy cho thấy rằng ta biết điều này một cách trực tiếp, không chỉ nói suông do đức tin, chữ "ma" (makāro) ở đây được nói để nối âm. "Này các Tỷ-kheo, đây là trường hợp thứ nhất" (Idaṃ, bhikkhave, paṭhamaṃ ṭhānanti), trong bốn trường hợp được nói bằng từ "sự việc" (vatthusaddena), đây là trường hợp thứ nhất, sự nhớ lại một trăm ngàn kiếp này là lý do thứ nhất.
Idāni sassato attā ca loko cātiādikāya paṭiññāya sādhanatthaṃ hetuṃ dassento ‘‘taṃ kissa hetu? Ahañhi ātappamanvāyā’’tiādimāha. Tattha imināmahaṃ etaṃ jānāmīti iminā visesādhigamena ahaṃ etaṃ paccakkhato jānāmi, na kevalaṃ saddhāmattakeneva vadāmīti dasseti, makāro panettha padasandhikaraṇatthaṃ vutto. Idaṃ, bhikkhave, paṭhamaṃ ṭhānanti catūhi vatthūhīti vatthusaddena vuttesu catūsu ṭhānesu idaṃ paṭhamaṃ ṭhānaṃ, idaṃ jātisatasahassamattānussaraṇaṃ paṭhamaṃ kāraṇanti attho.
32-33. In the two subsequent instances, the method is the same. Merely, this instance is stated in terms of recollection of many hundreds of thousands of births. The others in terms of recollection of ten and forty aeons of contraction and expansion. For a dull-witted sectarian recollects as many as a hundred thousand births, a moderately wise one recollects ten aeons of contraction and expansion, a sharp-witted one recollects forty, not beyond that.
32-33. Trong hai trường hợp tiếp theo, cách thức cũng tương tự. Chỉ có điều, trường hợp này được nói về sự nhớ lại nhiều trăm ngàn kiếp. Các trường hợp khác được nói về sự nhớ lại mười và bốn mươi thành kiếp và hoại kiếp. Vì người ngoại đạo có trí tuệ kém thì nhớ lại được một trăm ngàn kiếp, người có trí tuệ trung bình thì nhớ lại được mười thành kiếp và hoại kiếp, người có trí tuệ sắc bén thì nhớ lại được bốn mươi kiếp, không hơn nữa.
32-33. Upari vāradvayepi eseva nayo. Kevalañhi ayaṃ vāro anekajātisatasahassānussaraṇavasena vutto. Itare dasacattālīsasaṃvaṭṭavivaṭṭakappānussaraṇavasena. Mandapañño hi titthiyo anekajātisatasahassamattaṃ anussarati, majjhimapañño dasasaṃvaṭṭavivaṭṭakappāni, tikkhapañño cattālīsaṃ, na tato uddhaṃ.
34. In the fourth instance, "he speculates" means he is a speculator, or he has speculation, he is a speculator. This is a designation for one who grasps at views through speculating and pondering. "Endowed with investigation" means he is an investigator. Investigation is weighing, inclination, acceptance. Just as a man, having investigated the water with a stick, descends, in the same way, one who, having weighed, inclined, and made acceptable a view, grasps it, he should be understood as "an investigator." "Overwhelmed by speculation" means overwhelmed by speculation, having speculated by various methods. "Following after investigation" means following after that investigation of the aforementioned kind. "Own-devised" means arising only from one's own thinking. "He says thus", means he says thus taking hold of eternalist view.
34.Trong trường hợp thứ tư, "suy luận" (takkayatīti) là người suy luận (takkī), hoặc người có sự suy luận được gọi là người suy luận (takkī). Đây là một thuật ngữ chỉ cho những người chấp thủ tà kiến bằng cách suy luận, suy xét. "Đầy đủ sự suy xét" (Vīmaṃsāya samannāgatoti) là người suy xét (vīmaṃsī). "Suy xét" (Vīmaṃsā) nghĩa là sự cân nhắc, sự ưa thích, sự chấp nhận. Giống như một người đàn ông dò xét nước bằng cây gậy trước khi bước xuống, tương tự như vậy, người nào cân nhắc, ưa thích, chấp nhận tà kiến, thì người đó được hiểu là "người suy xét" (vīmaṃsī). "Bị đánh bại bởi suy luận" (Takkapariyāhatanti) nghĩa là bị đánh bại bởi suy luận, suy luận theo cách thức đó. "Đi theo sự suy xét" (Vīmaṃsānucaritanti) nghĩa là đi theo sự suy xét đã được nói. "Tự mình phát minh" (Sayaṃpaṭibhānanti) nghĩa là chỉ do sự phát minh của chính mình. "Nói như vậy" (Evamāhāti) nghĩa là chấp thủ tà kiến thường hằng và nói như vậy.
34. Catutthavāre takkayatīti takkī, takko vā assa atthīti takkī. Takketvā vitakketvā diṭṭhigāhino etaṃ adhivacanaṃ. Vīmaṃsāya samannāgatoti vīmaṃsī. Vīmaṃsā nāma tulanā ruccanā khamanā. Yathā hi puriso yaṭṭhiyā udakaṃ vīmaṃsitvā otarati, evameva yo tulayitvā ruccitvā khamāpetvā diṭṭhiṃ gaṇhāti, so ‘‘vīmaṃsī’’ti veditabbo. Takkapariyāhatanti takkena pariyāhataṃ, tena tena pariyāyena takketvāti attho. Vīmaṃsānucaritanti tāya vuttappakārāya vīmaṃsāya anucaritaṃ. Sayaṃpaṭibhānanti attano paṭibhānamattasañjātaṃ. Evamāhāti sassatadiṭṭhiṃ gahetvā evaṃ vadati.
Herein, there are four kinds of speculators: one who relies on hearsay, one who recollects past lives, one who is materially-successful, and one who speculates purely. Among them, he who grasps a view by speculating, “Since I have heard such things as, ‘There was a king named Vessantara,’” thinking, “If the Blessed One was indeed Vessantara, then the self is eternal,” this is one who relies on hearsay. He who recollects two or three past lives – speculating, “I myself was so-and-so in the past; therefore, the self is eternal,” is a past-life-recollecting speculator. He who, due to material success, speculates, “Just as my self is happy now, it was so in the past, and it will be so in the future,” and grasps a view, this is a materially-successful speculator. But one who grasps merely by speculating, “When this exists, that comes to be,” is a pure speculator.
Trong đó, có bốn loại người suy lý: Người suy lý do nghe (truyền thuyết), người suy lý do nhớ lại các kiếp trước, người suy lý do được lợi dưỡng, và người suy lý thuần túy. Trong đó, người nghe những điều như: "Đã có một vị vua tên là Vessantara," v.v., rồi suy lý: "Nếu đức Thế Tôn chính là Vessantara, thì ngã là thường còn," người này được gọi là người suy lý do nghe. Người nhớ lại hai, ba kiếp sống rồi suy lý: "Trước đây chính ta đã là người này người kia, do đó ngã là thường còn," người này là người suy lý do nhớ các kiếp trước. Còn người do được lợi dưỡng mà suy lý: "Như hiện nay ngã của ta được an lạc, trong quá khứ cũng như vậy, trong tương lai cũng sẽ như vậy," rồi chấp vào tà kiến, người này được gọi là người suy lý do được lợi dưỡng. Còn người chỉ suy lý suông: "Nếu như vậy thì cái này có," rồi chấp thủ, người này được gọi là người suy lý thuần túy.
Tattha catubbidho takkī – anussutiko, jātissaro, lābhī, suddhatakkikoti. Tattha yo ‘‘vessantaro nāma rājā ahosī’’tiādīni sutvā ‘‘tena hi yadi vessantarova bhagavā, sassato attā’’ti takkayanto diṭṭhiṃ gaṇhāti, ayaṃ anussutiko nāma. Dve tisso jātiyo saritvā – ‘‘ahameva pubbe asukasmiṃ nāma ahosiṃ, tasmā sassato attā’’ti takkayanto jātissaratakkiko nāma. Yo pana lābhitāya ‘‘yathā me idāni attā sukhī hoti, atītepi evaṃ ahosi, anāgatepi bhavissatī’’ti takkayitvā diṭṭhiṃ gaṇhāti, ayaṃ lābhītakkiko nāma. ‘‘Evaṃ sati idaṃ hotī’’ti takkamatteneva gaṇhanto pana suddhatakkiko nāma.
35. By one or other of these, means by one or two or three of these same four grounds. There is nothing beyond this, and he roars the irreversible lion's roar that there is no other single cause for the assertion of eternity besides these grounds.
35."Hoặc một trong những lý do này" nghĩa là một, hai, hoặc ba trong bốn lý do này. "Không có gì khác ngoài những điều này," nghĩa là ngoài những lý do này, không có bất kỳ một nguyên nhân nào khác dẫn đến sự khẳng định thường kiến, Ngài rống tiếng rống sư tử không gì lay chuyển.
35.Etesaṃ vā aññatarenāti etesaṃyeva catunnaṃ vatthūnaṃ aññatarena ekena vā dvīhi vā tīhi vā. Natthi ito bahiddhāti imehi pana vatthūhi bahi aññaṃ ekaṃ kāraṇampi sassatapaññattiyā natthīti appaṭivattiyaṃ sīhanādaṃ nadati.
36. That, monks, the Tathagata understands, means that the Tathagata, monks, understands that fourfold wrong view in various ways. Showing the way he understands that, he spoke, starting with: these stations of views. Here, views themselves are called stations of views. And the cause of views is also a station of views. As it is said: “What are the eight stations of views? The aggregates are a station of views, ignorance also, contact also, perception also, thought also, unwise attention also, bad friends also, another's utterance also is a station of view.” “The aggregates are the cause, the aggregates are the condition, on account of the arising as station of view; thus the aggregates also are a station of view. Ignorance is the cause... bad friends are the cause. Another's utterance is the cause, another's utterance is the condition, on account of the arising as station of view; thus another's utterance also is a station of view” (Paṭi. Ma. 1.124). Thus grasped, means that the stations of views, namely views – “the self and the world are eternal” – thus grasped, taken, that is the meaning. Thus adhered to, means adhered to and firmly held again and again with an unattached mind, established as ‘this alone is true, any other is delusion.’ But the stations of views, namely causes, as they grasp, views arise; thus they are grasped in terms of object, and in terms of arising, and in terms of practice. They are adhered to, by way of grasping again and again, due to not seeing the danger. Thus going, means going to one or other of these destinies: hell, the animal realm, the realm of the hungry ghosts. Thus in the future, is a synonym for the previous word, meaning thus in the future life.
36."Này các Tỳ kheo, Như Lai biết rõ điều này," nghĩa là: Này các Tỳ kheo, Như Lai biết rõ tất cả bốn loại tà kiến này theo nhiều phương diện khác nhau. Để chỉ rõ cách Ngài biết rõ điều đó, Ngài nói: "Những tà kiến này," v.v. Ở đây, tà kiến chính là chỗ nương của tà kiến. Hơn nữa, nguyên nhân của tà kiến cũng chính là chỗ nương của tà kiến. Như đã nói: "Thế nào là tám chỗ nương của tà kiến? Các uẩn cũng là chỗ nương của tà kiến, vô minh cũng vậy, xúc cũng vậy, tưởng cũng vậy, tư duy cũng vậy, tác ý không như lý cũng vậy, bạn ác cũng vậy, nghe từ người khác cũng là chỗ nương của tà kiến." "Các uẩn là nhân, các uẩn là duyên, vì ý nghĩa là khởi lên do chấp thủ chỗ nương của tà kiến, như vậy các uẩn cũng là chỗ nương của tà kiến. Vô minh là nhân… (v.v.)… bạn ác là nhân. Nghe từ người khác là nhân, nghe từ người khác là duyên, vì ý nghĩa là khởi lên do chấp thủ chỗ nương của tà kiến, như vậy nghe từ người khác cũng là chỗ nương của tà kiến" (Patisambhidāmagga 1.124). "Được chấp thủ như vậy," trước hết, chỗ nương của tà kiến, tức là tà kiến, - "Ngã và thế giới là thường còn," được chấp thủ như vậy, tức là được tiếp nhận, được phát khởi. "Được nắm giữ như vậy," nghĩa là do tâm không còn tham ái, được nắm giữ, được nắm giữ nhiều lần, được xác định là 'chỉ có điều này là chân thật, những điều khác là hư vọng'. Còn chỗ nương của tà kiến, tức là nguyên nhân, khi được nắm giữ theo cách nào đó, thì chúng khiến cho tà kiến khởi lên, do vậy được chấp thủ theo phương diện đối tượng, theo phương diện phát khởi, và theo phương diện thường xuyên thực hành. Vì không thấy sự nguy hại, nên được nắm giữ nhiều lần. "Có xu hướng như vậy," nghĩa là có xu hướng đi đến một trong các cảnh giới địa ngục, súc sinh, ngạ quỷ. "Có tương lai như vậy," đây là cách nói khác của cụm từ trước, nghĩa là có đời sau như vậy.
36.Tayidaṃ, bhikkhave, tathāgato pajānātīti bhikkhave, taṃ idaṃ catubbidhampi diṭṭhigataṃ tathāgato nānappakārato jānāti. Tato taṃ pajānanākāraṃ dassento ime diṭṭhiṭṭhānātiādimāha. Tattha diṭṭhiyova diṭṭhiṭṭhānā nāma. Api ca diṭṭhīnaṃ kāraṇampi diṭṭhiṭṭhānameva. Yathāha ‘‘katamāni aṭṭha diṭṭhiṭṭhānāni? Khandhāpi diṭṭhiṭṭhānaṃ, avijjāpi, phassopi , saññāpi, vitakkopi, ayonisomanasikāropi, pāpamittopi, paratoghosopi diṭṭhiṭṭhāna’’nti. ‘‘Khandhā hetu, khandhā paccayo diṭṭhiṭṭhānaṃ upādāya samuṭṭhānaṭṭhena, evaṃ khandhāpi diṭṭhiṭṭhānaṃ. Avijjā hetu…pe… pāpamitto hetu. Paratoghoso hetu, paratoghoso paccayo diṭṭhiṭṭhānaṃ upādāya samuṭṭhānaṭṭhena, evaṃ paratoghosopi diṭṭhiṭṭhāna’’nti (paṭi. ma. 1.124). Evaṃgahitāti diṭṭhisaṅkhātā tāva diṭṭhiṭṭhānā – ‘‘sassato attā ca loko cā’’ti evaṃgahitā ādinnā, pavattitāti attho. Evaṃparāmaṭṭhāti nirāsaṅkacittatāya punappunaṃ āmaṭṭhā parāmaṭṭhā, ‘idameva saccaṃ, moghamañña’nti pariniṭṭhāpitā . Kāraṇasaṅkhātā pana diṭṭhiṭṭhānā yathā gayhamānā diṭṭhiyo samuṭṭhāpenti, evaṃ ārammaṇavasena ca pavattanavasena ca āsevanavasena ca gahitā. Anādīnavadassitāya punappunaṃ gahaṇavasena parāmaṭṭhā. Evaṃgatikāti evaṃ nirayatiracchānapettivisayagatikānaṃ aññataragatikā. Evaṃ abhisamparāyāti idaṃ purimapadasseva vevacanaṃ, evaṃvidhaparalokāti vuttaṃ hoti.
And the Tathagata understands that, means that not only does the Tathagata understand wrong view along with its cause and destiny, but he also understands all of that, and he understands the superior virtue, and concentration, and the knowledge of omniscience. And he does not cling to that understanding, means that though understanding this kind of unexcelled distinction, he does not cling to it due to craving, view, and conceit, thinking, "I understand." And for him, not clinging, cessation is known personally, means that for him, not clinging, cessation of those clinging defilements is known individually by oneself, on account of that non-clinging. It is evident, monks, to the Tathagata, that is Nirvana.
"Như Lai biết rõ điều đó," Như Lai không chỉ biết rõ tà kiến cùng với nguyên nhân và xu hướng của nó, mà Ngài còn biết rõ tất cả những điều đó, và Ngài còn biết rõ hơn nữa về giới, định, và trí tuệ toàn giác. "Và Ngài không chấp thủ sự hiểu biết đó," nghĩa là dù biết rõ sự thù thắng vô thượng như vậy, Ngài cũng không chấp thủ nó theo phương diện tham ái, tà kiến, và ngã mạn, nghĩ rằng: "Ta biết." "Và do không chấp thủ, Ngài tự mình chứng ngộ Niết Bàn," nghĩa là do không chấp thủ, Ngài tự mình, do chính mình, chứng ngộ sự diệt trừ các phiền não chấp thủ đó. Ngài chỉ rõ: "Này các Tỳ kheo, Niết Bàn đã được hiển lộ cho Như Lai."
Tañca tathāgato pajānātīti na kevalañca tathāgato sakāraṇaṃ sagatikaṃ diṭṭhigatameva pajānāti, atha kho tañca sabbaṃ pajānāti, tato ca uttaritaraṃ sīlañceva samādhiñca sabbaññutaññāṇañca pajānāti. Tañca pajānanaṃ na parāmasatīti tañca evaṃvidhaṃ anuttaraṃ visesaṃ pajānantopi ahaṃ pajānāmīti taṇhādiṭṭhimānaparāmāsavasena tañca na parāmasati. Aparāmasato cassa paccattaññeva nibbuti viditāti evaṃ aparāmasato cassa aparāmāsapaccayā sayameva attanāyeva tesaṃ parāmāsakilesānaṃ nibbuti viditā. Pākaṭaṃ, bhikkhave, tathāgatassa nibbānanti dasseti.
Now, in order to show the practice by which that cessation was attained by the Tathagata, declaring the practice of meditation based on those very feelings in which the sectarians, being attached, enter the thicket of views, thinking, “Here we will be happy, in this place we will be happy,” he spoke, starting with: the arising of feelings. Herein, having understood as it really is, means “With the arising of ignorance, there is the arising of feeling, he sees the arising of the aggregate of feeling in terms of the arising of conditions; with the arising of craving, there is the arising of feeling, he sees the arising of the aggregate of feeling in terms of the arising of conditions; with the arising of kamma, there is the arising of feeling, he sees the arising of the aggregate of feeling in terms of the arising of conditions; with the arising of contact, there is the arising of feeling, he sees the arising of the aggregate of feeling in terms of the arising of conditions (Paṭi. Ma. 1.50). He also sees the arising of the aggregate of feeling seeing the characteristic of production.” Having understood the arising of feelings as it really is, according to these five characteristics; “With the cessation of ignorance, there is the cessation of feeling, he sees the ceasing of the aggregate of feeling in terms of the cessation of conditions; with the cessation of craving, there is the cessation of feeling, he sees the ceasing of the aggregate of feeling in terms of the cessation of conditions; with the cessation of kamma, there is the cessation of feeling, he sees the ceasing of the aggregate of feeling in terms of the cessation of conditions; with the cessation of contact, there is the cessation of feeling, he sees the ceasing of the aggregate of feeling in terms of the cessation of conditions. He also sees the ceasing of the aggregate of feeling seeing the characteristic of change” (Paṭi. Ma. 1.50), having understood the ending of feelings as it really is, according to these five characteristics, “Whatever happiness and joy arise dependent on feeling, this is the gratification in feeling” (Saṃ. Ni. 3.26), thus having understood gratification as it really is; “Whatever feeling is impermanent, suffering, subject to change, this is the danger in feeling,” thus having understood danger as it really is; “Whatever is the removal of desire and lust for feeling, the abandoning of desire and lust, this is the escape from feeling,” thus having understood escape as it really is; due to the absence of desire and lust, not clinging, the Tathagata, monks, is released without clinging; that is, due to the absence of that clinging, because of which, if there were any clinging, there would be a clinging, and due to clinging, there would be an aggregate, the Tathagata, monks, is released without clinging to any thing.
Bây giờ, để chỉ rõ con đường mà Như Lai đã thực hành để chứng đắc Niết Bàn đó, Ngài bắt đầu giảng về pháp hành (nghiệp xứ) liên quan đến các cảm thọ, mà những người ngoại đạo tham đắm vào đó, đi vào sự chấp thủ tà kiến, nghĩ rằng: "Ở đây ta sẽ được an lạc, ở đó ta sẽ được an lạc." Ngài nói: "Biết rõ như thật sự sinh khởi của các cảm thọ," v.v. Ở đây, "biết rõ như thật," nghĩa là: "Do vô minh sinh khởi, cảm thọ sinh khởi," thấy sự sinh khởi của uẩn cảm thọ theo phương diện duyên sinh. "Do ái sinh khởi, cảm thọ sinh khởi," thấy sự sinh khởi của uẩn cảm thọ theo phương diện duyên sinh. "Do nghiệp sinh khởi, cảm thọ sinh khởi," thấy sự sinh khởi của uẩn cảm thọ theo phương diện duyên sinh. "Do xúc sinh khởi, cảm thọ sinh khởi," thấy sự sinh khởi của uẩn cảm thọ theo phương diện duyên sinh (Patisambhidāmagga 1.50). "Thấy tướng trạng sinh khởi cũng là thấy sự sinh khởi của uẩn cảm thọ," theo năm đặc tính này, biết rõ như thật sự sinh khởi của các cảm thọ; "Do vô minh diệt, cảm thọ diệt," thấy sự diệt của uẩn cảm thọ theo phương diện duyên diệt. "Do ái diệt, cảm thọ diệt," thấy sự diệt của uẩn cảm thọ theo phương diện duyên diệt. "Do nghiệp diệt, cảm thọ diệt," thấy sự diệt của uẩn cảm thọ theo phương diện duyên diệt. "Do xúc diệt, cảm thọ diệt," thấy sự diệt của uẩn cảm thọ theo phương diện duyên diệt. "Thấy tướng trạng biến hoại cũng là thấy sự diệt của uẩn cảm thọ" (Patisambhidāmagga 1.50), theo năm đặc tính này, biết rõ như thật sự diệt tận của các cảm thọ, "Do duyên cảm thọ, lạc thọ, hỷ thọ sinh khởi, đó là vị ngọt của cảm thọ" (Samyutta Nikaya 3.26), biết rõ như thật vị ngọt như vậy, "Cảm thọ là vô thường, khổ, có tính chất biến hoại, đó là sự nguy hại của cảm thọ," biết rõ như thật sự nguy hại như vậy, "Sự điều phục tham ái, sự từ bỏ tham ái đối với cảm thọ, đó là sự xuất ly khỏi cảm thọ," biết rõ như thật sự xuất ly như vậy, do lìa tham ái, không chấp thủ, "Này các Tỳ kheo, Như Lai là bậc không chấp thủ, giải thoát"; đối với sự chấp thủ nào, khi có sự chấp thủ đó, thì sẽ chấp thủ một điều gì đó, và do chấp thủ nên có uẩn, do không có sự chấp thủ đó, nên không chấp thủ bất kỳ pháp nào, Như Lai là bậc giải thoát, này các Tỳ kheo.
Idāni yathāpaṭipannena tathāgatena sā nibbuti adhigatā, taṃ paṭipattiṃ dassetuṃ yāsu vedanāsu rattā titthiyā ‘‘idha sukhino bhavissāma, ettha sukhino bhavissāmā’’ti diṭṭhigahanaṃ pavisanti, tāsaṃyeva vedanānaṃ vasena kammaṭṭhānaṃ ācikkhanto vedanānaṃ samudayañcātiādimāha. Tattha yathābhūtaṃ viditvāti ‘‘avijjāsamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, taṇhāsamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, kammasamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati, phassasamudayā vedanāsamudayoti paccayasamudayaṭṭhena vedanākkhandhassa udayaṃ passati (paṭi. ma. 1.50). Nibbattilakkhaṇaṃ passantopi vedanākkhandhassa udayaṃ passatī’’ti imesaṃ pañcannaṃ lakkhaṇānaṃ vasena vedanānaṃ samudayaṃ yathābhūtaṃ viditvā; ‘‘avijjānirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati, taṇhānirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati , kammanirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati, phassanirodhā vedanānirodhoti paccayanirodhaṭṭhena vedanākkhandhassa vayaṃ passati. Vipariṇāmalakkhaṇaṃ passantopi vedanākkhandhassa vayaṃ passatī’’ti (paṭi. ma. 1.50) imesaṃ pañcannaṃ lakkhaṇānaṃ vasena vedanānaṃ atthaṅgamaṃ yathābhūtaṃ viditvā, ‘‘yaṃ vedanaṃ paṭicca uppajjati sukhaṃ somanassaṃ, ayaṃ vedanāya assādo’’ti (saṃ. ni. 3.26) evaṃ assādañca yathābhūtaṃ viditvā, ‘‘yaṃ vedanā aniccā dukkhā vipariṇāmadhammā, ayaṃ vedanāya ādīnavo’’ti evaṃ ādīnavañca yathābhūtaṃ viditvā, ‘‘yo vedanāya chandarāgavinayo chandarāgappahānaṃ, idaṃ vedanāya nissaraṇa’’nti evaṃ nissaraṇañca yathābhūtaṃ viditvā vigatachandarāgatāya anupādāno anupādāvimutto, bhikkhave, tathāgato; yasmiṃ upādāne sati kiñci upādiyeyya, upādinnattā ca khandho bhaveyya, tassa abhāvā kiñci dhammaṃ anupādiyitvāva vimutto bhikkhave tathāgatoti.
37. These indeed, monks, means those things about which I asked – “What, monks, are those things that are profound” – described thus: “These indeed, monks, the Tathagata understands, and he understands the superior,” these things of the knowledge of omniscience should be understood as profound, hard to see... to be experienced by the wise. Regarding which, neither a worldling, nor any among stream-enterers and others, can speak the true praise, but only the Tathagata can speak the true praise, rightly speaking; thus even by questioning, only the knowledge of omniscience was questioned, and even by explaining, only that was explained, but in between, views were classified.
37."Này các Tỳ Kheo, những pháp này," nghĩa là những pháp mà Ta đã hỏi: "Này các Tỳ Kheo, những pháp nào là sâu xa," được trình bày như: "Này các Tỳ Kheo, Như Lai biết rõ điều đó và Ngài còn biết rõ hơn nữa," những pháp trí tuệ toàn giác được trình bày như vậy là sâu xa, khó thấy... (v.v.)... chỉ có bậc trí mới liễu tri được. Đối với những pháp này, không phải phàm phu, cũng không phải một trong các bậc Dự lưu, v.v., có thể nói đúng như thật về công đức của Như Lai, mà chỉ có Như Lai mới có thể nói đúng như thật, nói một cách chân chính về công đức của mình," như vậy, dù được hỏi về trí tuệ toàn giác, nhưng câu trả lời cũng chỉ rõ về trí tuệ toàn giác đó, trong khi đó, các tà kiến được phân tích.
37.Ime kho te, bhikkhaveti ye te ahaṃ – ‘‘katame, ca te, bhikkhave, dhammā gambhīrā’’ti apucchiṃ, ‘‘ime kho te, bhikkhave, tañca tathāgato pajānāti tato ca uttaritaraṃ pajānātī’’ti evaṃ niddiṭṭhā sabbaññutaññāṇadhammā gambhīrā duddasā…pe… paṇḍitavedanīyāti veditabbā. Yehi tathāgatassa neva puthujjano, na sotāpannādīsu aññataro vaṇṇaṃ yathābhūtaṃ vattuṃ sakkoti, atha kho tathāgatova yathābhūtaṃ vaṇṇaṃ sammā vadamāno vadeyyāti evaṃ pucchamānenāpi sabbaññutaññāṇameva puṭṭhaṃ, niyyātentenāpi tadeva niyyātitaṃ, antarā pana diṭṭhiyo vibhattāti.
The exposition of the First Recitation Section is finished.
Phần sớ giải Phẩm thứ nhất được hoàn tất.
Paṭhamabhāṇavāravaṇṇanā niṭṭhitā.
Exposition of the Partial-Eternalists
Sớ giải về Thường kiến một phần.
Ekaccasassatavādavaṇṇanā
38. Partial-eternalists, means those who believe in partial eternity. They are of two kinds: those who hold some beings to be eternal, and those who hold some formations to be eternal. Both kinds are included here.
38."Thường kiến một phần" nghĩa là những người chủ trương thường kiến một phần. Họ có hai loại: Thường kiến một phần về chúng sinh, và thường kiến một phần về hành. Cả hai loại đều được bao gồm ở đây.
38.Ekaccasassatikāti ekaccasassatavādā. Te duvidhā honti – sattekaccasassatikā, saṅkhārekaccasassatikāti. Duvidhāpi idha gahitāyeva.
39. That is just a particle. Sometimes, means at some time. Another time, is a synonym for that. After a long period, means after the passing of a long time. Rolls up, means perishes. Mostly, is said with reference to those who are reborn in the higher Brahma-worlds or in the formless realms, and the remainder. Made of mind because it is produced by that jhana. Feeding on joy, means that joy is their food. Self-luminous, means they are of their own light. Moving in the sky, means they move in the sky. Abiding in beauty, means they abide in beautiful gardens, heavenly mansions, wish-fulfilling trees, etc., or they abide being adorned with beautiful, delightful things and ornaments, abiding in beauty. For a long time, a long period, means for a maximum of eight aeons.
39."Có" chỉ là một từ nối. "Đôi khi" nghĩa là vào một thời điểm nào đó. "Có lúc" cũng có nghĩa tương tự. "Thời gian dài" nghĩa là khoảng thời gian dài. "Trôi qua" nghĩa là vượt qua. "Hoại diệt" nghĩa là tiêu tan. "Phần lớn" nghĩa là những chúng sinh sinh lên các cõi trời Phạm thiên cao hơn hoặc các cõi trời Vô sắc, nói đến những chúng sinh còn lại. Do ý (tâm) tạo ra thiền, nên được gọi là ý hành. Thức ăn, sự nuôi dưỡng của họ là hỷ, nên gọi là hỷ thực. Ánh sáng của họ tự phát ra, nên gọi là tự quang. Đi lại trong hư không, nên gọi là hư không hành. Trú ở những nơi tốt đẹp như vườn cảnh, lâu đài, cây cối, v.v., nên gọi là trú xứ tốt đẹp, hoặc trú với những vật trang sức, y phục tốt đẹp, đáng ưa thích, nên gọi là trú xứ tốt đẹp. "Lâu dài, một thời gian dài," nghĩa là tối đa là tám kiếp.
39.Yanti nipātamattaṃ. Kadācīti kismiñci kāle. Karahacīti tasseva vevacanaṃ. Dīghassaaddhunoti dīghassa kālassa. Accayenāti atikkamena . Saṃvaṭṭatīti vinassati. Yebhuyyenāti ye uparibrahmalokesu vā arūpesu vā nibbattanti, tadavasese sandhāya vuttaṃ. Jhānamanena nibbattattā manomayā. Pīti tesaṃ bhakkho āhāroti pītibhakkhā. Attanova tesaṃ pabhāti sayaṃpabhā. Antalikkhe carantīti antalikkhacarā. Subhesu uyyānavimānakapparukkhādīsu tiṭṭhantīti, subhaṭṭhāyino subhā vā manorammavatthābharaṇā hutvā tiṭṭhantīti subhaṭṭhāyino. Ciraṃ dīghamaddhānanti ukkaṃsena aṭṭha kappe.
40. Rolls out, means remains. The Brahma-mansion is empty, means that it is empty due to the natural absence of beings born there, that is the meaning that it is the plane of the Brahma-group. There is no maker or creator of it, but according to the method stated in the Path of Purification, a jewel-plane arises due to the power of kamma and seasons. Here, gardens, wish-fulfilling trees, etc., arise only in the places of natural rebirth. Then, in the natural dwelling places of beings, longing arises, they cultivate the first jhana and descend from there, therefore he spoke, starting with: Then a certain being. Either through the exhaustion of life-span or through the exhaustion of merit, means those who, having performed abundant meritorious kamma, are reborn in any lesser divine world, cannot remain there due to their own merit, but pass away according to the life-span of that divine world; they are said to pass away through the exhaustion of life-span. But those who, having performed slight meritorious kamma, are reborn in long-lived divine worlds, cannot remain there for the full life-span, but pass away in between; they are said to pass away through the exhaustion of merit. He abides for a long period, means an aeon or half an aeon.
40."Thành tựu" nghĩa là an trụ. "Cung điện Phạm thiên trống rỗng," nghĩa là trống rỗng do tự nhiên không có chúng sinh nào sinh ra, nghĩa là cõi Phạm thiên. Không có ai tạo ra hay sai khiến nó, mà theo như đã nói trong Thanh Tịnh Đạo, cõi báu sinh ra do duyên nghiệp và duyên thời tiết. Ở những nơi vốn tự nhiên sinh ra, các thứ như vườn cảnh, cây cối, v.v., sinh ra ở đây. Rồi đối với chúng sinh, ở nơi vốn là chỗ ở tự nhiên, sự luyến ái sinh khởi, họ tu tập sơ thiền rồi hạ xuống từ đó, do đó nói: "Rồi có một chúng sinh," v.v. "Do mạng sống kết thúc hoặc phước báu kết thúc," những ai làm nghiệp phước lớn, sinh ra ở bất kỳ cõi trời nào có tuổi thọ ngắn, họ không thể ở lại do năng lực phước báu của mình, mà chết theo tuổi thọ của cõi trời đó, nên được gọi là chết do mạng sống kết thúc. Còn những ai làm nghiệp phước nhỏ, sinh ra ở cõi trời có tuổi thọ dài, họ không thể ở cho đến hết tuổi thọ, mà chết giữa chừng, nên được gọi là chết do phước báu kết thúc. "Trú ở đó một thời gian dài," nghĩa là một kiếp, hoặc nửa kiếp.
40.Vivaṭṭatīti saṇṭhāti. Suññaṃ brahmavimānanti pakatiyā nibbattasattānaṃ natthitāya suññaṃ, brahmakāyikabhūmi nibbattatīti attho. Tassa kattā vā kāretā vā natthi, visuddhimagge vuttanayena pana kammapaccayautusamuṭṭhānā ratanabhūmi nibbattati. Pakatinibbattiṭṭhānesuyeva cettha uyyānakapparukkhādayo nibbattanti. Atha sattānaṃ pakatiyā vasitaṭṭhāne nikanti uppajjati, te paṭhamajjhānaṃ bhāvetvā tato otaranti, tasmā atha kho aññataro sattotiādimāha. Āyukkhayā vā puññakkhayā vāti ye uḷāraṃ puññakammaṃ katvā yattha katthaci appāyuke devaloke nibbattanti, te attano puññabalena ṭhātuṃ na sakkonti, tassa pana devalokassa āyuppamāṇeneva cavantīti āyukkhayā cavantīti vuccanti. Ye pana parittaṃ puññakammaṃ katvā dīghāyukadevaloke nibbattanti, te yāvatāyukaṃ ṭhātuṃ na sakkonti, antarāva cavantīti puññakkhayā cavantīti vuccanti. Dīghamaddhānaṃ tiṭṭhatīti kappaṃ vā upaḍḍhakappaṃ vā.
41. Discontent is the longing for the arrival of another being. But that which is connected with aversion, with being troubled, does not exist in the Brahma-world. Being agitated is being startled, trembling, and this has four kinds: the agitation of fear, the agitation of craving, the agitation of views, and the agitation of knowledge. Among these, “because of birth there is fear, terror, consternation, horripilation, mental agitation. Because of aging…sickness…death…there is agitation” (Vibha. 921), this is called the agitation of fear. “Oh, may other beings come to this state!” (D.iii.38) this is called the agitation of craving. “That which is agitated, trembles” this is called the agitation of views. "Those, having heard the Dhamma teaching of the Tathāgata, mostly experience fear, alarm, terror” (A.iv.33) this is called the agitation of knowledge. Here, however, both the agitation of craving and the agitation of views are applicable. Brahma-mansion, here, it has not been said to be empty because of the existence of the first arisen one. They attain by way of rebirth, they approach. Companionship means the state of being together.
41. Không hoan hỷ (Anabhirati) là mong cầu sự xuất hiện của một chúng sinh khác. Còn sự bực bội (ukkaṇṭhitā) liên hệ đến sân hận thì không có ở cõi Phạm thiên. Lo âu (Paritassanā) là kinh hãi, run sợ, nó có bốn loại là: sợ hãi do kinh hãi (tāsatassanā), sợ hãi do tham ái (taṇhātassanā), sợ hãi do tà kiến (diṭṭhitassanā), sợ hãi do trí tuệ (ñāṇatassanā). Trong đó, "Vì duyên vào sinh mà có sợ hãi, kinh hoàng, rùng mình, sởn tóc gáy, tâm hoảng loạn. Vì duyên vào già... bệnh... tử... mà có tâm hoảng loạn" (vibha. 921), đây gọi là sợ hãi do kinh hãi. "Ôi ước gì các chúng sinh khác đến cõi này" (dī. ni. 3.38), đây gọi là sợ hãi do tham ái. "Chỉ có lo âu và dao động" (Paritassitavipphanditamevā), đây gọi là sợ hãi do tà kiến. "Và họ, sau khi nghe Như Lai thuyết pháp, phần lớn đều sinh ra sợ hãi, xúc động, kinh hoàng" (a. ni. 4.33), đây gọi là sợ hãi do trí tuệ. Ở đây, cả sợ hãi do tham ái và sợ hãi do tà kiến đều có thể xảy ra. Phạm thiên giới (Brahmavimānanti) ở đây, không nói là trống rỗng vì sự hiện hữu của vị (Phạm thiên) đầu tiên. Đến (Upapajjantī) là đi đến bằng cách tái sinh. Cùng chung (Sahabyatan) là cùng chung một trạng thái.
41.Anabhiratīti aparassāpi sattassa āgamanapatthanā. Yā pana paṭighasampayuttā ukkaṇṭhitā, sā brahmaloke natthi. Paritassanāti ubbijjanā phandanā, sā panesā tāsatassanā, taṇhātassanā, diṭṭhitassanā, ñāṇatassanāti catubbidhā hoti. Tattha ‘‘jātiṃ paṭicca bhayaṃ bhayānakaṃ chambhitattaṃ lomahaṃso cetaso utrāso. Jaraṃ… byādhiṃ… maraṇaṃ paṭicca…pe… utrāso’’ti (vibha. 921) ayaṃ tāsatassanā nāma. ‘‘Aho vata aññepi sattā itthattaṃ āgaccheyyu’’nti (dī. ni. 3.38) ayaṃ taṇhātassanā nāma. ‘‘Paritassitavipphanditamevā’’ti ayaṃ diṭṭhitassanā nāma. ‘‘Tepi tathāgatassa dhammadesanaṃ sutvā yebhuyyena bhayaṃ saṃvegaṃ santāsaṃ āpajjantī’’ti (a. ni. 4.33) ayaṃ ñāṇatassanā nāma. Idha pana taṇhātassanāpi diṭṭhitassanāpi vaṭṭati. Brahmavimānanti idha pana paṭhamābhinibbattassa atthitāya suññanti na vuttaṃ. Upapajjantīti upapattivasena upagacchanti. Sahabyatanti sahabhāvaṃ.
42. Abhibhū (the Conqueror) means, having conquered, he stands as the eldest, thinking “I am.” Unconquered means, unconquered by others. Aññadatthū (Seer of what pertains to others) is an indeclinable in the sense of definite assertion. Seeing in the sense of vision, meaning “I see all”. Vasavattī (Wielder of Power), I turn all people under my power. Issara (Lord), Creator, Maker, I am the lord of the world, I am the creator and maker of the world, the earth— the Himavantas, Sineru, the Cakkavāḷa-mountains, the great ocean, the moon, and the sun—were made by me. The Superior, the Fashioner, I am the most excellent and the fashioner of the world, “You shall be a noble, you shall be a brahmin, a merchant, a worker, a householder, a recluse. At the very least, you shall be a camel, you shall be an ox," thinking thus “I distribute beings.” The Master, the Father of those who have become and those who are becoming (D.i.17), I am the master through practiced mastery, I am the father of those who have become and those who are becoming, thus he thinks. Among them, those beings born from eggs and wombs are called “becoming” inside the eggshell and inside the womb, from the time of going forth, they are called “become”. Those born of moisture are “becoming” in the first moment of consciousness, from the second onwards, they are called “become”. Those spontaneously born should be understood as “becoming” in the first posture, from the second onwards, as “become”. Because of the thought “all of them are my sons”, he thinks “I am the father of those who have become and those who are becoming”.
42. Đấng Chiến Thắng (Abhibhū) là đã chiến thắng, ngự trị như người đứng đầu. Đấng Bất Bại (Anabhibhūto) là không bị ai chiến thắng. Thấy được mọi sự (Aññadatthū) là từ đơn, chỉ một trường hợp. Thấy (daso) là do việc thấy, nghĩa là thấy tất cả. Tự Chủ (Vasavattī) là ta điều khiển mọi người theo ý muốn. Tự Tại (Issaro) là Đấng Tạo Hóa (kattā) là Đấng Hóa Sinh (nimmātā) là ta là Đấng Tự Tại của thế gian, ta là Đấng Tạo Hóa và Hóa Sinh của thế gian, đất - núi Tuyết Sơn - núi Tu Di - núi Chakkavāḷa (luân vi sơn) - biển cả - mặt trăng - mặt trời là do ta hóa sinh. Tối Thượng (Seṭṭho) là Đấng Sáng Tạo (sajitā) là ta là bậc tối thượng và là đấng sáng tạo của thế gian, "Ngươi hãy là Sát-đế-lỵ, ngươi hãy là Bà-la-môn, Phệ-xá, Thủ-đà-la, cư sĩ, hay Sa-môn. Thậm chí ngươi hãy là con lạc đà, hãy là con bò", "Ta phân chia chúng sinh như vậy" - vị ấy nghĩ vậy. Đấng Tối Thắng, Cha của các loài đã sinh và sẽ sinh (Vasī pitā bhūtabhabyānanti) (dī. ni. 1.17) ta là Đấng Tối Thắng đã đạt được sự tự chủ, ta là cha của các loài đã sinh và sẽ sinh - vị ấy nghĩ vậy. Trong đó, chúng sinh noãn sinh và thai sinh, trong thời gian còn trong vỏ trứng và trong bụng mẹ, gọi là sẽ sinh, từ lúc ra khỏi (vỏ trứng, bụng mẹ) gọi là đã sinh. Loài thấp sinh ở sát-na tâm đầu tiên gọi là sẽ sinh, từ sát-na thứ hai trở đi gọi là đã sinh. Loài hóa sinh ở oai nghi đầu tiên gọi là sẽ sinh, từ oai nghi thứ hai trở đi gọi là đã sinh. Tất cả chúng ấy, vì nghĩ là con của ta, nên nghĩ "ta là cha của các loài đã sinh và sẽ sinh".
42.Abhibhūti abhibhavitvā ṭhito jeṭṭhakohamasmīti. Anabhibhūtoti aññehi anabhibhūto. Aññadatthūti ekaṃsavacane nipāto. Dassanavasena daso, sabbaṃ passāmīti attho. Vasavattīti sabbaṃ janaṃ vase vattemi. Issaro kattā nimmātāti ahaṃ loke issaro, ahaṃ lokassa kattā ca nimmātā ca, pathavī – himavanta-sineru-cakkavāḷa-mahāsamudda-candima-sūriyā mayā nimmitāti. Seṭṭho sajitāti ahaṃ lokassa uttamo ca sajitā ca, ‘‘tvaṃ khattiyo nāma hohi, tvaṃ brāhmaṇo, vesso, suddo, gahaṭṭho, pabbajito nāma. Antamaso tvaṃ oṭṭho hohi, goṇo hohī’’ti ‘‘evaṃ sattānaṃ saṃvisajetā aha’’nti maññati. Vasī pitā bhūtabhabyānanti (dī. ni. 1.17) ahamasmi ciṇṇavasitāya vasī, ahaṃ pitā bhūtānañca bhabyānañcāti maññati. Tattha aṇḍajajalābujā sattā antoaṇḍakose ceva antovatthimhi ca bhabyā nāma, bahi nikkhantakālato paṭṭhāya bhūtā nāma. Saṃsedajā paṭhamacittakkhaṇe bhabyā, dutiyato paṭṭhāya bhūtā. Opapātikā paṭhamairiyāpathe bhabyā, dutiyato paṭṭhāya bhūtāti veditabbā. Te sabbepi mayhaṃ puttāti saññāya ‘‘ahaṃ pitā bhūtabhabyāna’’nti maññati.
Now, desiring to establish it with reasoning, having made the declaration, “These beings were created by me,” he said, “For what reason?” and so on. To this state means to this condition, to the state of Brahma. By me here, though they have passed away and have been reborn due to their own kamma, merely by the mere thought “we were created by me here,” bowing down like a crooked peg in a crooked hole, they go to the very foot of that one.
Nay, muốn chứng minh bằng lý do, sau khi khẳng định "Những chúng sinh này do ta hóa sinh", ngài nói: "Vì lý do gì..." (taṃ kissa hetū). Trạng thái này (Itthattanti) là trạng thái như vậy, nghĩa là trạng thái Phạm thiên. Do ta (Iminā mayanti), dù cho có chết đi và tái sinh theo nghiệp của mình, nhưng chỉ do suy nghĩ suông mà cho rằng "chúng ta do vị này hóa sinh", giống như cây tre cong có lỗ cắm nêm, cúi đầu và đi đến dưới chân của vị ấy.
Idāni kāraṇato sādhetukāmo – ‘‘mayā ime sattā nimmitā’’ti paṭiññaṃ katvā ‘‘taṃ kissa hetū’’tiādimāha. Itthattanti itthabhāvaṃ, brahmabhāvanti attho. Iminā mayanti attano kammavasena cutāpi upapannāpi ca kevalaṃ maññanāmatteneva ‘‘iminā mayaṃ nimmitā’’ti maññamānā vaṅkacchidde vaṅkaāṇī viya onamitvā tasseva pādamūlaṃ gacchantīti.
43. More beautiful, more lovely, meaning more pleasant. More majestic, more powerful in terms of lordship and retinue.
43. Có dung sắc thù thắng hơn (Vaṇṇavantataro cā) là có dung sắc thù thắng hơn, đẹp đẽ, khả ái. Có oai lực lớn hơn (Mahesakkhataro) là có uy danh lớn hơn do uy quyền và quyến thuộc.
43.Vaṇṇavantataro cāti vaṇṇavantataro, abhirūpo pāsādikoti attho. Mahesakkhataroti issariyaparivāravasena mahāyasataro.
44. There is indeed a reason for this, he does not go elsewhere after passing away from there, he comes right here, with reference to that this was said. From a house, from a home. Homelessness means reclusion. For reclusion is, because that activity of a householder like farming, cattle-rearing, etc., is not there, therefore it is called homelessness. He goes forth, he approaches. Beyond that, he does not recollect, he does not remember beyond that former existence, being unable to remember, remaining there, he grasps the view.
44. Có khả năng (Ṭhānaṃkho panetan) là có lý do. Vị ấy không đi đến nơi khác sau khi chết ở đó, mà đến đây, nói như vậy là ám chỉ điều này. Gia đình (Agārasmā) là nhà. Xuất gia (Anagāriyan) là sự từ bỏ gia đình. Vì sự xuất gia không có những việc như cày ruộng, chăn bò… của gia đình, nên gọi là không gia đình (anagāriya). Xuất gia (Pabbajatī) là đi đến. Không nhớ gì sau đó (Tato paraṃ nānussaratī) là không nhớ gì về đời trước sau đó, không thể nhớ, dừng lại ở đó và chấp vào tà kiến.
44.Ṭhānaṃkho panetanti kāraṇaṃ kho panetaṃ. So tato cavitvā aññatra na gacchati, idheva āgacchati, taṃ sandhāyetaṃ vuttaṃ. Agārasmāti gehā. Anagāriyanti pabbajjaṃ. Pabbajjā hi yasmā agārassa hi taṃ kasigorakkhādikammaṃ tattha natthi, tasmā anagāriyanti vuccati. Pabbajatīti upagacchati. Tato paraṃ nānussaratīti tato pubbenivāsā paraṃ na sarati, sarituṃ asakkonto tattha ṭhatvā diṭṭhiṃ gaṇhāti.
Among eternal, etc., not seeing his rebirth, he says eternal, not seeing death, he says constant, because of the continuous existence, he says everlasting, because of the absence of change even due to aging, he says of unchanging nature. The rest here is just as explained in the first case.
Trong các từ "thường hằng"... (Niccotiādīsu), không thấy sự tái sinh của vị ấy, nên nói là thường hằng, không thấy sự chết nên nói là thường trú, vì luôn luôn hiện hữu nên nói là thường còn, vì không có sự biến đổi ngay cả do tuổi già, nên nói là không có bản chất biến đổi. Phần còn lại ở đây cũng giống như đoạn đầu.
Niccotiādīsu tassa upapattiṃ apassanto niccoti vadati, maraṇaṃ apassanto dhuvoti, sadābhāvato sassatoti, jarāvasenāpi vipariṇāmassa abhāvato avipariṇāmadhammoti. Sesamettha paṭhamavāre uttānamevāti.
45-46. In the second case, they are corrupted by amusement, they perish, thus they are amusement-corrupted, they also write the reading corrupted, but that is not in the commentary. Excessive means too much time, very long. Abounding in mirth and amusement, attached to mirth and abounding in amusement, engaged in, being engaged in the pleasure of play and laughter, and the pleasure of physical and verbal sport, being endowed with the aforementioned kind of delight, they dwell.
45-46. Trong đoạn thứ hai, bị ô nhiễm và hủy diệt bởi trò vui (khiḍḍāya padussanti vinassantīti) là Khiḍḍāpadosikā (những vị bị ô nhiễm bởi trò vui). Cũng có bản viết là Padūsikā (những vị bị ô nhiễm), nhưng không có trong Chú giải. Quá mức (Ativelan) là quá thời gian, quá lâu. Đắm mình trong sự vui đùa, hỷ lạc (Hassakhiḍḍāratidhammasamāpannā) là đắm mình trong hỷ lạc, trò vui, và hỷ lạc, nghĩa là, say mê trong sự vui đùa, hỷ lạc của thân thể, và sự vui đùa, hỷ lạc của lời nói, đầy đủ sự hỷ lạc như đã nói, sống như vậy.
45-46. Dutiyavāre khiḍḍāya padussanti vinassantīti khiḍḍāpadosikā, padūsikātipi pāḷiṃ likhanti, sā aṭṭhakathāyaṃ natthi. Ativelanti atikālaṃ, aticiranti attho. Hassakhiḍḍāratidhammasamāpannāti hassarati dhammañceva khiḍḍāratidhammañca samāpannā anuyuttā, keḷihassasukhañceva kāyikavācasikakīḷāsukhañca anuyuttā, vuttappakāraratidhammasamaṅgino hutvā viharantīti attho.
Mindfulness is lost, mindfulness is lost in regard to things to be eaten and food. Those, sporting in festivals with the great majesty of their splendor attained through special merit, because of that greatness of attainment— “We have partaken of food, we have not partaken of food”, they do not even know. Then, from the passing of one meal onwards, though continuously eating and drinking, they pass away, they do not remain. Why? Because of the strength of the kamma-produced heat, the weakness of the body produced by action, for in humans, the kamma-produced heat is weak, the body produced by action is strong. Because of the weakness of the heat, because of the strength of the body produced by action, even after the passing of a week, it is possible to sustain the body with hot water, clear gruel, etc. But for deities, the heat is strong, that produced by action is weak. Those, having passed even one mealtime, are not able to remain firm. Just as a lotus or a water-lily placed on a hot stone in the midday of the summer, even though sprinkled with a hundred pots of water in the evening, does not become normal, it perishes indeed. Similarly, though later continuously eating and drinking, they pass away indeed, they do not remain. Therefore, he said, “Through the loss of mindfulness, those deities pass away from that body.” But which deities are they? These deities, in the commentary, there is no analysis, but because it is said generally, “For deities, the kamma-produced heat is strong, that produced by action is weak”, whichever deities subsisting on solid food do thus, those same ones pass away. But some say, “Those deities are the Nimmanarati and Paranimmita-vasavatti devas.” Merely by the corruption of amusement, these are called amusement-corrupted. The rest here should be understood as in the previous way.
Mất niệm (Sati sammussatī) là mất niệm đối với thức ăn cứng và thức ăn mềm. Nghe nói, các vị ấy, vì đạt được phước báu thù thắng, với sự huy hoàng của mình, vui đùa trong các lễ hội, vì sự huy hoàng vĩ đại ấy, không biết "chúng ta đã ăn hay chưa ăn". Rồi từ sau khi bỏ bữa một lần, dù có liên tục ăn và uống, các vị ấy vẫn chết, không thể tồn tại. Vì sao? Vì sức mạnh của nghiệp hỏa (kammajatejassa balavatāya), thân do vật chất tạo ra (karajakāyassa mandatāya) yếu kém. Đối với người, nghiệp hỏa yếu kém, thân do vật chất tạo ra mạnh mẽ. Vì nghiệp hỏa của họ yếu kém, thân do vật chất tạo ra mạnh mẽ, nên dù có qua bảy ngày, vẫn có thể duy trì, chống đỡ bằng nước nóng, cháo loãng… Nhưng đối với chư thiên, nghiệp hỏa mạnh mẽ, thân do vật chất tạo ra yếu kém. Họ, chỉ cần qua một thời gian bỏ bữa, là không thể duy trì. Ví như hoa sen hay hoa súng đặt trên đá nóng vào giữa trưa mùa hè, dù có tưới bằng trăm bình nước vào buổi chiều, cũng không thể trở lại bình thường, mà sẽ héo tàn. Cũng vậy, sau đó, dù có liên tục ăn và uống, các vị ấy vẫn chết, không thể tồn tại. Vì thế, ngài nói: "Vì quên niệm, các vị thiên ấy chết từ thân đó". Nhưng đó là những vị thiên nào? Các vị thiên này (không được chỉ rõ). Trong Chú giải không có sự phân biệt, nhưng vì nói chung rằng "Nghiệp hỏa của chư thiên mạnh mẽ, thân do vật chất tạo ra yếu kém", nên bất cứ chư thiên nào sống nhờ vào thức ăn cứng, làm như vậy, thì chết, cần phải hiểu như vậy. Tuy nhiên, một số vị nói rằng: "Đó là chư thiên Nimmanarati (Hóa Lạc Thiên) và Paranimmita-vasavatti (Tha Hóa Tự Tại Thiên)". Chỉ do bị ô nhiễm bởi trò vui, nên gọi là Khiḍḍāpadosikā (những vị bị ô nhiễm bởi trò vui). Phần còn lại ở đây cần hiểu như trước.
Sati sammussatīti khādanīyabhojanīyesu sati sammussati. Te kira puññavisesādhigatena mahantena attano sirivibhavena nakkhattaṃ kīḷantā tāya sampattimahantatāya – ‘‘āhāraṃ paribhuñjimha, na paribhuñjimhā’’tipi na jānanti. Atha ekāhārātikkamanato paṭṭhāya nirantaraṃ khādantāpi pivantāpi cavantiyeva, na tiṭṭhanti. Kasmā? Kammajatejassa balavatāya, karajakāyassa mandatāya, manussānañhi kammajatejo mando, karajakāyo balavā. Tesaṃ tejassa mandatāya karajakāyassa balavatāya sattāhampi atikkamitvā uṇhodakaacchayāguādīhi sakkā vatthuṃ upatthambhetuṃ. Devānaṃ pana tejo balavā hoti, karajaṃ mandaṃ. Te ekaṃ āhāravelaṃ atikkamitvāva saṇṭhātuṃ na sakkonti. Yathā nāma gimhānaṃ majjhanhike tattapāsāṇe ṭhapitaṃ padumaṃ vā uppalaṃ vā sāyanhasamaye ghaṭasatenāpi siñciyamānaṃ pākatikaṃ na hoti, vinassatiyeva. Evameva pacchā nirantaraṃ khādantāpi pivantāpi cavantiyeva, na tiṭṭhanti. Tenāha ‘‘satiyā sammosā te devā tamhā kāyā cavantī’’ti. Katame pana te devāti? Ime devāti aṭṭhakathāyaṃ vicāraṇā natthi, ‘‘devānaṃ kammajatejo balavā hoti, karajaṃ manda’’nti avisesena vuttattā pana ye keci kabaḷīkārāhārūpajīvino devā evaṃ karonti, teyeva cavantīti veditabbā. Keci panāhu – ‘‘nimmānaratiparanimmitavasavattino te devā’’ti. Khiḍḍāpadussanamatteneva hete khiḍḍāpadosikāti vuttā. Sesamettha purimanayeneva veditabbaṃ.
47-48. In the third case, they are corrupted by mind, they perish, thus they are mind-corrupted, these are of the Cātumahārājika-devas. Among them, it is said that one deva-son— “I will sport in a festival,” with his retinue, goes along the street in a chariot, then another, coming out, seeing him going in front— ‘This wretch’, seeing him as if never seen before— “As if inflated with joy, as if bursting, he goes,” he becomes angry. The one going in front also, turning back, seeing him angry— angry ones are well known, having known his state of anger— “You are angry, what will you do to me? This attainment has been gained by me through giving, virtue, etc., not by your power,” he becomes angry in return. For when one is angry, the other, not angry, protects, but when both are angry, the anger of one becomes the condition for the other. And the anger of that one becomes the condition for the other, both, weeping like prisoners, they pass away. This is the nature of things here. The rest should be understood as stated before.
47-48. Trong đoạn thứ ba, bị ô nhiễm và hủy diệt bởi tâm (manena padussanti vinassantīti) là Manopadosikā (những vị bị ô nhiễm bởi tâm), đây là chư thiên Tứ Đại Thiên Vương (Cātumahārājikā). Nghe nói, trong số họ, một vị thiên tử, nghĩ rằng "ta sẽ vui đùa trong lễ hội", cùng với quyến thuộc, đi trên đường bằng xe, một vị khác đi ra, thấy vị ấy đi trước, nghĩ rằng: "Ôi kẻ khốn khổ này", như chưa từng thấy, thấy vị ấy, "như sưng phồng lên vì hoan hỷ và như sắp vỡ tung", rồi nổi giận. Vị đi trước quay lại, thấy vị ấy nổi giận, biết được sự giận dữ của vị ấy vì người giận dữ thì dễ nhận biết, "ngươi giận dữ, ngươi sẽ làm gì được ta, sự thành tựu này ta có được là do bố thí, trì giới… không phải do ngươi", rồi nổi giận đáp lại. Khi một vị nổi giận, vị kia không giận dữ thì được bảo vệ, nhưng khi cả hai đều giận dữ, sự giận dữ của vị này là duyên cho vị kia. Và sự giận dữ của vị kia là duyên cho vị này, cả hai đều la hét và chết. Đây là bản chất của sự việc ở đây. Phần còn lại cần hiểu như đã nói.
47-48. Tatiyavāre manena padussanti vinassantīti manopadosikā, ete cātumahārājikā. Tesu kira eko devaputto – nakkhattaṃ kīḷissāmīti saparivāro rathena vīthiṃ paṭipajjati, athañño nikkhamanto taṃ purato gacchantaṃ disvā – ‘bho ayaṃ kapaṇo’, adiṭṭhapubbaṃ viya etaṃ disvā – ‘‘pītiyā uddhumāto viya bhijjamāno viya ca gacchatī’’ti kujjhati. Purato gacchantopi nivattitvā taṃ kuddhaṃ disvā – kuddhā nāma suviditā hontīti kuddhabhāvamassa ñatvā – ‘‘tvaṃ kuddho, mayhaṃ kiṃ karissasi, ayaṃ sampatti mayā dānasīlādīnaṃ vasena laddhā, na tuyhaṃ vasenā’’ti paṭikujjhati. Ekasmiñhi kuddhe itaro akuddho rakkhati, ubhosu pana kuddhesu ekassa kodho itarassa paccayo hoti. Tassapi kodho itarassa paccayo hotīti ubho kandantānaṃyeva orodhānaṃ cavanti. Ayamettha dhammatā. Sesaṃ vuttanayeneva veditabbaṃ.
49-52. In speculative views, this one sees the division of the eye, etc., but because the mind, each earlier one having given its condition to each later one, ceases, therefore, more powerful than the division of the eye, etc., he does not see the division of the mind. That one, not seeing that, just as a bird, having abandoned one tree, alights on another, similarly, when this selfhood is broken, the mind goes elsewhere, having grasped thus, he speaks thus. The rest here should be understood as stated before.
49-52. Trong luận thuyết về suy luận (Takkīvāde), vị này thấy sự khác biệt của mắt… nhưng vì tâm, cái trước trước diệt đi, trao duyên cho cái sau sau, nên dù có mạnh hơn sự khác biệt của mắt…, cũng không thấy sự khác biệt của tâm. Vị ấy, không thấy điều đó, ví như con chim bỏ cây này bay đến đậu ở cây khác, cũng vậy, khi thân này tan rã, tâm đi đến nơi khác, chấp thủ như vậy và nói như vậy. Phần còn lại ở đây cần hiểu như đã nói.
49-52. Takkīvāde ayaṃ cakkhādīnaṃ bhedaṃ passati, cittaṃ pana yasmā purimaṃ purimaṃ pacchimassa pacchimassa paccayaṃ datvāva nirujjhati, tasmā cakkhādīnaṃ bhedato balavatarampi cittassa bhedaṃ na passati. So taṃ apassanto yathā nāma sakuṇo ekaṃ rukkhaṃ jahitvā aññasmiṃ nilīyati, evameva imasmiṃ attabhāve bhinne cittaṃ aññatra gacchatīti gahetvā evamāha. Sesamettha vuttanayeneva veditabbaṃ.
The Description of the End-and-Limit Theorists
Phần giải thích về luận thuyết về Hữu biên và Vô biên.
Antānantavādavaṇṇanā
53. End-and-limit theorists means the end-and-limit views, meaning views that arise concerning the end or the limit or the end-and-limit or neither-end-nor-limit.
53. Những người theo thuyết Hữu biên và Vô biên (Antānantikāti) là những người theo luận thuyết về Hữu biên và Vô biên, nghĩa là, luận thuyết khởi lên do chấp vào hữu biên, hoặc vô biên, hoặc hữu biên và vô biên, hoặc không phải hữu biên không phải vô biên.
53.Antānantikāti antānantavādā, antaṃ vā anantaṃ vā antānantaṃ vā nevantānānantaṃ vā ārabbha pavattavādāti attho.
54-60. He dwells in the world with a perception of end, not extending the counterpart sign to the limit of the world-sphere, grasping that— “the world,” he dwells in the world with a perception of end, but one with the extended kasiṇa, having made it to the limit of the world-sphere, is one with a perception of limitlessness, but not extending above and below, but extending across, having a perception of end above and below, across, a perception of limitlessness. The speculative view should be understood as stated before. These four, all of them, because they are grasped by views according to what has been seen and heard before, have entered into the speculations concerning the past.
54-60. Sống trong thế gian với tưởng hữu biên (Antasaññīlokasmiṃ viharatī) là không mở rộng tướng đối chiếu (paṭibhāganimittaṃ) đến tận cùng vòng Chakkavāḷa (luân vi), chấp thủ đó là "thế gian" và sống trong thế gian với tưởng hữu biên. Còn vị đã mở rộng kasina (biến xứ) đến tận cùng vòng Chakkavāḷa thì có tưởng vô biên. Không mở rộng lên trên và xuống dưới, mà mở rộng theo chiều ngang, thì có tưởng hữu biên ở trên và dưới, tưởng vô biên theo chiều ngang. Luận thuyết về suy luận cần hiểu như đã nói. Bốn vị này, vì chấp thủ tà kiến theo như đã từng thấy, nên thuộc về các chấp thủ về quá khứ.
54-60.Antasaññīlokasmiṃ viharatīti paṭibhāganimittaṃ cakkavāḷapariyantaṃ avaḍḍhetvā taṃ – ‘‘loko’’ti gahetvā antasaññī lokasmiṃ viharati, cakkavāḷapariyantaṃ katvā vaḍḍhitakasiṇo pana anantasaññī hoti, uddhamadho avaḍḍhetvā pana tiriyaṃ vaḍḍhetvā uddhamadho antasaññī, tiriyaṃ anantasaññī. Takkīvādo vuttanayeneva veditabbo. Ime cattāropi attanā diṭṭhapubbānusāreneva diṭṭhiyā gahitattā pubbantakappikesu paviṭṭhā.
The Description of the Wriggling-Eel Theorists
Phần giải thích về luận thuyết Amarāvikkhepa (Bất Tử Loạn Chuyển).
Amarāvikkhepavādavaṇṇanā
61. "They do not die" means the deathless. What is that? It is both the view and the speech of one holding to endless views in the manner of "It is not thus for me", and so on. Various wriggling is diversion, the diversion of the view and speech of the deathless is the deathless-wriggling. That is in them, thus they are called “deathless-wriggling”. Another method – "deathless" is the name of a certain kind of fish, that, moving in the water by way of surfacing and diving, cannot be caught. In the same way, this view, wandering hither and thither, does not allow itself to be caught. That is in them, thus they are called “deathless-wriggling”.
61. Không chết được gọi là “bất tử” (amarā). Đó là gì? Đó là quan điểm và lời nói của kẻ tà kiến, không có giới hạn theo cách thức như: “ngay cả như vậy, tôi cũng không”. Vikkhepo (phân tán, rối loạn) có nghĩa là nhiều loại, amarāvikkhepo (sự quanh co bất tử) là sự phân tán của tà kiến và tà ngữ, những người này có điều đó nên được gọi là amarāvikkhepikā (những kẻ quanh co bất tử). Một cách giải thích khác – amarā là tên một loại cá, nó bơi lội trong nước theo cách trồi lên hụp xuống, không thể bắt được. Cũng vậy, luận thuyết này di chuyển từ chỗ này sang chỗ kia, không đi đến chỗ nắm bắt được, nên được gọi là amarāvikkhepo. Những người này có điều đó nên được gọi là amarāvikkhepikā.
61. Na maratīti amarā. Kā sā? Evantipi me notiādinā nayena pariyantarahitā diṭṭhigatikassa diṭṭhi ceva vācā ca. Vividho khepoti vikkhepo, amarāya diṭṭhiyā vācāya ca vikkhepoti amarāvikkhepo, so etesaṃ atthīti amarāvikkhepikā, aparo nayo – amarā nāma ekā macchajāti, sā ummujjananimujjanādivasena udake sandhāvamānā gahetuṃ na sakkāti, evameva ayampi vādo itocito ca sandhāvati, gāhaṃ na upagacchatīti amarāvikkhepoti vuccati. So etesaṃ atthīti amarāvikkhepikā.
62. He does not understand "this is wholesome" as it really is, means he does not understand the ten courses of wholesome action as they really are. Even in the unwholesome, the ten unwholesome courses of action are implied. "That would be a pain to me" means "if I spoke falsely" that would be a pain to me, through the arising of remorse, there would be suffering, is the meaning. "That would be a hindrance to me" means that it would be a hindrance to my heaven and path. Through fear of false speech and avoidance of false speech, means through the sense of shame and the sense of moral dread in regard to false speech. "He falls into the wriggling of speech" means he falls into the diversion of speech. Of what kind? Deathless-wriggling, meaning endless diversion.
62. Không thực sự hiểu biết “đây là thiện” nghĩa là không thực sự hiểu biết mười nghiệp thiện theo như thật. Trong bất thiện cũng bao hàm mười nghiệp bất thiện. “Điều đó có thể gây hại cho ta” nghĩa là sự hối hận khởi lên “ta đã nói dối”, điều đó có thể gây hại, gây khổ cho ta. “Điều đó có thể gây chướng ngại cho ta” nghĩa là nó có thể gây chướng ngại cho ta đến cõi trời và đạo lộ. Vì sợ nói dối, nhờ tàm và quý đối với sự nói dối, nên ghê tởm việc nói dối. Đạt đến sự tán loạn về lời nói, nghĩa là đạt đến sự tán loạn bằng lời nói. Loại nào? Amarāvikkhepaṃ, nghĩa là sự tán loạn không có giới hạn.
62.‘‘Idaṃkusala’’nti yathābhūtaṃ nappajānātīti dasa kusalakammapathe yathābhūtaṃ nappajānātīti attho. Akusalepi dasa akusalakammapathāva adhippetā. So mamassa vighātoti ‘‘musā mayā bhaṇita’’nti vippaṭisāruppattiyā mama vighāto assa, dukkhaṃ bhaveyyāti attho. So mamassa antarāyoti so mama saggassa ceva maggassa ca antarāyo assa. Musāvādabhayā musāvādaparijegucchāti musāvāde ottappena ceva hiriyā ca. Vācāvikkhepaṃ āpajjatīti vācāya vikkhepaṃ āpajjati. Kīdisaṃ? Amarāvikkhepaṃ, apariyantavikkhepanti attho.
In “It is not thus for me", and so on, "It is not thus for me" is uncertain diversion. "It is not so for me", denies the eternalist view that was stated: “the self and the world are eternal". "It is not otherwise for me" denies the semi-eternalist view that was stated as otherwise than eternal. "It is not not for me" denies the annihilation view stated as: “the Tathagata does not exist after death". "It is not not-not for me" denies the speculative view stated as: “one neither exists nor does not exist”. But if he himself is asked: "Is this wholesome?" or "Is this unwholesome?", he declares nothing. Asked "Is this wholesome?" he says, "It is not thus for me". Then, when asked, "Is it unwholesome?", he says, "It is not so for me". When asked, "Is it otherwise than both?", he says, "It is not otherwise for me". Then, when asked, "It is not in any of the three ways, what is your view?" he says, "It is not not for me". Then, when asked, "What is your view that it is not not?" he says, "It is not not-not for me". Thus he just falls into diversion, he does not stand on any single position.
Trong câu “ngay cả như vậy, tôi cũng không” (evantipi me no) v.v..., “ngay cả như vậy, tôi cũng không” là sự tán loạn không xác định. “Tôi cũng không như thế” (Tathātipi me no) là bác bỏ thường kiến “linh hồn và thế giới là thường còn” đã được nói. “Tôi cũng không khác” (Aññathātipi me no) là bác bỏ thuyết “một phần thường còn” được nói khác với thường kiến. “Tôi cũng không phải là không” (Notipi me no) – bác bỏ đoạn kiến được nói là “Như Lai không tồn tại sau khi chết”. “Tôi cũng không phải là không phải là không” (No notipi me no) là bác bỏ luận chấp của những nhà suy lý được nói là “không phải tồn tại, không phải không tồn tại”. Nhưng khi được hỏi “đây là thiện” hay “bất thiện”, bản thân người ấy không trả lời gì cả. Khi được hỏi “đây là thiện”, người ấy nói “ngay cả như vậy, tôi cũng không”. Rồi khi được hỏi “vậy là bất thiện?”, người ấy nói “tôi cũng không như thế”. Khi được hỏi “vậy là khác với cả hai?”, người ấy nói “tôi cũng không khác”. Rồi khi được hỏi “vậy là không theo cả ba cách, kiến giải của ông là gì?”, người ấy nói “tôi cũng không phải là không”. Rồi khi được hỏi “vậy kiến giải không phải là không của ông là gì?”, người ấy nói “tôi cũng không phải là không phải là không”, như vậy là đạt đến sự tán loạn, không dừng lại ở một lập trường nào.
Evantipi me notiādīsu evantipi me noti aniyamitavikkhepo . Tathātipi me noti ‘‘sassato attā ca loko cā’’ti vuttaṃ sassatavādaṃ paṭikkhipati. Aññathātipi me noti sassatato aññathā vuttaṃ ekaccasassataṃ paṭikkhipati. Notipi me noti – ‘‘na hoti tathāgato paraṃ maraṇā’’ti vuttaṃ ucchedaṃ paṭikkhipati. No notipi me noti ‘‘neva hoti na na hotī’’ti vuttaṃ takkīvādaṃ paṭikkhipati. Sayaṃ pana ‘‘idaṃ kusala’’nti vā ‘‘akusala’’nti vā puṭṭho na kiñci byākaroti. ‘‘Idaṃ kusala’’nti puṭṭho ‘‘evantipi me no’’ti vadati. Tato ‘‘kiṃ akusala’’nti vutte ‘‘tathātipi me no’’ti vadati. ‘‘Kiṃ ubhayato aññathā’’ti vutte ‘‘aññathātipi me no’’ti vadati. Tato ‘‘tividhenāpi na hoti, kiṃ te laddhī’’ti vutte ‘‘notipi me no’’ti vadati. Tato ‘‘kiṃ no noti te laddhī’’ti vutte ‘‘no notipi me no’’ti evaṃ vikkhepameva āpajjati, ekasmimpi pakkhe na tiṭṭhati.
63. "Desire or lust" means, even though not knowing, having suddenly said that only the wholesome is "wholesome" and only the unwholesome is "unwholesome" and having asked other wise men "I have declared thus to so-and-so, is that well declared?", and they say: "It is well declared, noble one, you have declared only the wholesome as wholesome, and only the unwholesome as unwholesome", then "there is no wise man like me," thus there would be desire or lust in me there, is the meaning. Here, desire is weak lust, lust is strong lust. "Aversion or repugnance" means, having said of the wholesome "it is unwholesome" or of the unwholesome "it is wholesome," and having asked other wise men, and when they say: "You have spoken badly," then "I do not even know this much," thus there would be aversion or repugnance in me there, is the meaning. Here too, aversion is weak anger, repugnance is strong anger.
63. Dục và tham, nghĩa là dù không biết, khi đã lỡ nói thiện là “thiện”, bất thiện là “bất thiện”, rồi hỏi những người có trí khác rằng “tôi đã tuyên bố như vậy với người nào đó, điều đó có được tuyên bố tốt không?”, những vị kia nói – “đã được tuyên bố tốt, này hiền giả, ông đã tuyên bố thiện là thiện, bất thiện là bất thiện”, thì liền nghĩ “không có người trí nào như ta”, như vậy dục và tham có thể khởi lên nơi ta. Ở đây, dục là tham yếu, tham là tham mạnh. Sân và hiềm hận, nghĩa là khi đã lỡ nói thiện là “bất thiện”, bất thiện là “thiện”, rồi hỏi những người có trí khác, những vị kia nói – “ông đã tuyên bố sai”, thì liền nghĩ “ngay cả chừng đó ta còn không biết”, như vậy sân và hiềm hận có thể khởi lên nơi ta. Ở đây, sân là phẫn nộ yếu, hiềm hận là phẫn nộ mạnh.
63.Chando vā rāgo vāti ajānantopi sahasā kusalameva ‘‘kusala’’nti vatvā akusalameva ‘‘akusala’’nti vatvā mayā asukassa nāma evaṃ byākataṃ, kiṃ taṃ subyākatanti aññe paṇḍite pucchitvā tehi – ‘‘subyākataṃ, bhadramukha, kusalameva tayā kusalaṃ, akusalameva akusalanti byākata’’nti vutte natthi mayā sadiso paṇḍitoti evaṃ me tattha chando vā rāgo vā assāti attho. Ettha ca chando dubbalarāgo, rāgo balavarāgo. Doso vā paṭigho vāti kusalaṃ pana ‘‘akusala’’nti, akusalaṃ vā ‘‘kusala’’nti vatvā aññe paṇḍite pucchitvā tehi – ‘‘dubyākataṃ tayā’’ti vutte ettakampi nāma na jānāmīti tattha me assa doso vā paṭigho vāti attho. Idhāpi doso dubbalakodho, paṭigho balavakodho.
"That would be a clinging to me, that would be a pain to me" means that duality of desire and lust would be a clinging to me, that duality of aversion and repugnance would be a pain. Both, indeed, by way of firm grasping is clinging, by way of destroying is pain. For lust grasps at the object through not wanting to let go, like a leech. Aversion, through wanting to destroy, is like a venomous snake. Both of these are indeed destructive through burning, thus they are called "clinging" and "pain". The rest is the same as in the first case.
Điều đó có thể là chấp thủ của ta, điều đó có thể gây hại cho ta, nghĩa là hai loại dục và tham đó có thể là chấp thủ của ta, hai loại sân và hiềm hận là sự gây hại. Hoặc cả hai đều là chấp thủ do nắm giữ chặt, là sự gây hại do sự hãm hại. Vì tham nắm giữ đối tượng do ý muốn không từ bỏ, như con đỉa. Sân do ý muốn tiêu diệt, như con rắn độc. Cả hai điều này do đặc tính thiêu đốt nên hãm hại, vì vậy được nói là “chấp thủ” và “gây hại”. Phần còn lại tương tự như đoạn đầu.
Taṃmamassa upādānaṃ, so mamassa vighātoti taṃ chandarāgadvayaṃ mama upādānaṃ assa, dosapaṭighadvayaṃ vighāto. Ubhayampi vā daḷhaggahaṇavasena upādānaṃ , vihananavasena vighāto. Rāgo hi amuñcitukāmatāya ārammaṇaṃ gaṇhāti jalūkā viya. Doso vināsetukāmatāya āsīviso viya. Ubhopi cete santāpakaṭṭhena vihananti yevāti ‘‘upādāna’’nti ca ‘‘vighāto’’ti ca vuttā. Sesaṃ paṭhamavārasadisameva.
64. "Wise" means endowed with wisdom. "Subtle" means having a fine and subtle intellect, capable of penetrating subtle differences of meaning. "Those who have refuted the doctrines of others" means both those who understand the doctrines of others and those who are experienced in debate with others. "Like sharp-shooters" means like an archer skilled in splitting a hair. "They seem to shatter" means they wander about seeming to shatter with their knowledge even the subtle views of others, like splitting a hair with a hair-splitter, is the meaning. "They would question me there", those recluses and brahmins would question me there, about those wholesome and unwholesome things. "Would cross-examine me" means they would ask about my view, saying, "What is wholesome, what is unwholesome, speak your view." "Would thoroughly question me" means that when I say "It is so-and-so", they would ask the reason, "For what reason would you accept this matter?" "Would confute me" means when I say, "For such-and-such a reason", they would show the fault in the reason and cross-examine me, saying: "You do not know this. Accept this instead. Reject this." "I would not be able to satisfy them" means I would not satisfy them, I would not be able to speak having satisfied them, is the meaning. "That would be a pain to me", this not satisfying even after speaking again and again, that would be a pain to me, it would only be the suffering of drying up the lips, palate, tongue and throat, is the meaning. Here too, the rest is the same as in the first case.
64. Paṇḍitā (những người có trí) nghĩa là những người đầy đủ trí tuệ. Nipuṇā (những người tinh tế) nghĩa là những người có trí tuệ vi tế, sâu sắc, có khả năng thấu hiểu những vấn đề sâu sắc. Kataparappavādā (những người đã tranh luận với ngoại đạo) nghĩa là những người đã hiểu biết về ngoại đạo và đã có kinh nghiệm tranh luận với người khác. Vālavedhirūpā (như những người bắn tên xuyên sợi lông) nghĩa là giống như những người bắn tên xuyên sợi lông. Họ dường như phá tan, nghĩa là dường như họ đi phá tan những tà kiến sâu sắc của người khác bằng trí tuệ của mình, như người bắn tên xuyên sợi lông. Họ ở đó với ta, nghĩa là những Sa-môn, Bà-la-môn đó với ta trong những thiện và bất thiện đó. Samanuyuñjeyyuṃ (hỏi vặn) nghĩa là họ có thể hỏi về kiến giải “thiện là gì, bất thiện là gì, hãy nói kiến giải của ông”. Samanugāheyyuṃ (hỏi nguyên do) nghĩa là khi được nói “là như thế này”, họ có thể hỏi nguyên do “do nguyên nhân nào mà chấp nhận ý nghĩa này”. Samanubhāseyyuṃ (hỏi cật vấn) nghĩa là khi được nói “do nguyên nhân này”, họ chỉ ra lỗi trong nguyên nhân và nói “ông không biết điều này, hãy chấp nhận điều này, hãy từ bỏ điều này”, như vậy họ có thể hỏi vặn. Na sampāyeyyanti (không thể trình bày) nghĩa là không thể trình bày, không thể trình bày và nói rõ. Điều đó có thể gây hại cho ta, nghĩa là việc dù nói đi nói lại mà vẫn không thể trình bày đó, điều đó có thể gây hại cho ta, chỉ có sự khổ do khô miệng, vòm miệng, lưỡi và cổ họng mà thôi. Ở đây, phần còn lại cũng tương tự như đoạn đầu.
64.Paṇḍitāti paṇḍiccena samannāgatā. Nipuṇāti saṇhasukhumabuddhino sukhumaatthantaraṃ paṭivijjhanasamatthā. Kataparappavādāti viññātaparappavādā ceva parehi saddhiṃ katavādaparicayā ca. Vālavedhirūpāti vālavedhidhanuggahasadisā. Te bhindantā maññeti vālavedhi viya vālaṃ sukhumānipi paresaṃ diṭṭhigatāni attano paññāgatena bhindantā viya carantīti attho. Te maṃ tatthāti te samaṇabrāhmaṇā maṃ tesu kusalākusalesu. Samanuyuñjeyyunti ‘‘kiṃ kusalaṃ, kiṃ akusalanti attano laddhiṃ vadā’’ti laddhiṃ puccheyyuṃ. Samanugāheyyunti ‘‘idaṃ nāmā’’ti vutte ‘‘kena kāraṇena etamatthaṃ gāheyyu’’nti kāraṇaṃ puccheyyuṃ. Samanubhāseyyunti ‘‘iminā nāma kāraṇenā’’ti vutte kāraṇe dosaṃ dassetvā ‘‘na tvaṃ idaṃ jānāsi, idaṃ pana gaṇha, idaṃ vissajjehī’’ti evaṃ samanuyuñjeyyuṃ. Na sampāyeyyanti na sampādeyyaṃ, sampādetvā kathetuṃ na sakkuṇeyyanti attho. So mamassa vighātoti yaṃ taṃ punappunaṃ vatvāpi asampāyanaṃ nāma, so mama vighāto assa, oṭṭhatālujivhāgalasosanadukkhameva assāti attho. Sesametthāpi paṭhamavārasadisameva.
65-66. "Dull" means of dull wisdom, this is a name for one who is unwise. "Utterly confused" means exceedingly confused. In "exists, the Tathagata" and so on, being is implied by "Tathagata". Here, the rest is obvious. These four also are included among the speculators about the past since they have grasped at views based only on previously occurring things.
65-66. Manda (ngu si) nghĩa là người có trí tuệ kém cỏi, đây là tên của người không có trí tuệ. Momūha (rất mê mờ) nghĩa là người cực kỳ mê mờ. Hotitathāgato (Như Lai tồn tại) v.v..., ở đây, chúng sinh được hiểu là “Như Lai”. Ở đây, phần còn lại đã rõ nghĩa. Bốn hạng người này cũng được bao gồm trong những người chấp thủ về phần cuối của kiếp (pubbantakappika) do chấp thủ tà kiến theo những pháp đã khởi lên trước đó.
65-66.Mandoti mandapañño apaññassevetaṃ nāmaṃ. Momūhoti atisammūḷho. Hotitathāgatotiādīsu satto ‘‘tathāgato’’ti adhippeto. Sesamettha uttānameva. Imepi cattāro pubbe pavattadhammānusāreneva diṭṭhiyā gahitattā pubbantakappikesu paviṭṭhā.
Discourse on the Speculators of Spontaneous Origin
Giải thích về luận chấp Ngẫu nhiên sinh khởi
Adhiccasamuppannavādavaṇṇanā
67. The view that "the self and the world arose spontaneously" is spontaneous origin. They hold this, thus they are "spontaneous-origin-ists". "Spontaneous origin" means arising without a cause.
67. Quan điểm “linh hồn và thế giới ngẫu nhiên sinh khởi” là adhiccasamuppannaṃ (ngẫu nhiên sinh khởi). Những người này có quan điểm đó nên được gọi là adhiccasamuppannikā (những người chấp thủ ngẫu nhiên sinh khởi). Adhiccasamuppannanti (ngẫu nhiên sinh khởi) nghĩa là sinh khởi không có nguyên nhân.
67. ‘‘Adhiccasamuppanno attā ca loko cā’’ti dassanaṃ adhiccasamuppannaṃ. Taṃ etesaṃ atthīti adhiccasamuppannikā. Adhiccasamuppannanti akāraṇasamuppannaṃ.
68-73. "Non-percipient beings" this is a designation, meaning beings in a form-only existence without thought-production. Their arising should be understood thus: a certain one, having gone forth in a sect, having developed the preliminary work on the wind-device, produces the fourth jhāna, emerges from jhāna, and sees a fault in consciousness – "when there is consciousness there is the suffering of cutting off hands and so on and all fears, enough of this consciousness, it is peaceful only to be without consciousness". Thus seeing a fault in consciousness, and not having fallen away from jhāna, he passes away and is reborn among the non-percipient beings. His consciousness ceases here with the cessation of his death-consciousness, and only the form aggregate arises there. Just as, for example, an arrow shot with the force of a bowstring goes in the sky as far as the force of the bowstring carries it, in the same way, having been impelled by the force of jhāna, they arise and remain as long as the force of jhāna lasts. But when the force of jhāna is exhausted, the form aggregate disappears there, and here rebirth-consciousness arises. Because, however, their decease there is known by the consciousness that has arisen here, it is said, "and with the arising of perception, those gods pass away from that body." "To continuity" means to the state of continuity. Here the rest is obvious. The speculative view, too, should be understood in the same way as stated.
68-73. Asaññasattā (chúng sinh vô tưởng) là cách gọi của bài giảng, nghĩa là trạng thái chỉ có sắc, không có tâm sinh khởi. Sự sinh khởi của những chúng sinh này nên được hiểu như sau – một người nào đó xuất gia trong ngoại đạo, sau khi làm cho viên mãn đề mục biến xứ gió (vāyokasiṇa), chứng đắc Tứ thiền, sau khi xuất thiền – “thấy lỗi lầm trong tâm, khi có tâm thì có sự khổ do cắt tay v.v... và tất cả những sự sợ hãi, thôi đủ rồi với cái tâm này, trạng thái không có tâm mới là an tịnh”, như vậy thấy lỗi lầm trong tâm, sau khi mệnh chung với thiền không bị suy giảm, liền sinh vào cõi chúng sinh vô tưởng, tâm của người ấy diệt mất ở đây cùng với sự diệt của tâm tử, chỉ có uẩn sắc hiện khởi ở đó. Những chúng sinh đó giống như mũi tên được bắn ra do sức căng của dây cung, bay trong không trung bao lâu còn sức căng của dây cung. Cũng vậy, họ được sinh ra do sức mạnh của thiền, tồn tại bao lâu còn sức mạnh của thiền, nhưng khi sức mạnh của thiền bị suy giảm, uẩn sắc ở đó biến mất, ở đây thì tưởng tái sinh khởi lên. Vì tưởng đó khởi lên ở đây mà sự tử của họ ở đó được nhận biết, nên nói “do sự khởi lên của tưởng, những vị chư thiên đó liền mệnh chung từ thân đó”. Santatāyā (cho sự tương tục) nghĩa là cho trạng thái tương tục. Ở đây, phần còn lại đã rõ nghĩa. Luận chấp của những nhà suy lý cũng nên được hiểu theo cách thức đã nói.
68-73.Asaññasattāti desanāsīsametaṃ, acittuppādā rūpamattakaattabhāvāti attho. Tesaṃ evaṃ uppatti veditabbā – ekacco hi titthāyatane pabbajitvā vāyokasiṇe parikammaṃ katvā catutthajjhānaṃ nibbattetvā jhānā vuṭṭhāya – ‘‘citte dosaṃ passati, citte sati hatthacchedādidukkhañceva sabbabhayāni ca honti, alaṃ iminā cittena, acittakabhāvova santo’’ti, evaṃ citte dosaṃ passitvā aparihīnajjhāno kālaṃ katvā asaññasattesu nibbattati, cittamassa cuticittanirodhena idheva nivattati, rūpakkhandhamattameva tattha pātubhavati. Te tattha yathā nāma jiyāvegakkhitto saro yattako jiyāvego, tattakameva ākāse gacchati. Evameva jhānavegakkhittā upapajjitvā yattako jhānavego, tattakameva kālaṃ tiṭṭhanti, jhānavege pana parihīne tattha rūpakkhandho antaradhāyati, idha pana paṭisandhisaññā uppajjati. Yasmā pana tāya idha uppannasaññāya tesaṃ tattha cuti paññāyati, tasmā ‘‘saññuppādā ca pana te devā tamhā kāyā cavantī’’ti vuttaṃ. Santatāyāti santabhāvāya. Sesamettha uttānameva. Takkīvādopi vuttanayeneva veditabboti.
Discourse on the Speculators about the Future
Giải thích về những người chấp thủ về phần sau của kiếp (Aparantakappikavaṇṇanā)
Aparantakappikavaṇṇanā
74. Thus, having shown the eighteen speculators about the past, now, to show the forty-four speculators about the future, he says: "There are, bhikkhus", and so on. There, taking the future as representing an endless division, they are called "speculators about the future", the future is in them, thus they are "speculators about the future". Thus, the rest should also be understood in the same way as previously stated.
74. Như vậy, sau khi trình bày mười tám loại chấp thủ về phần đầu của kiếp, bây giờ để trình bày bốn mươi bốn loại chấp thủ về phần sau của kiếp, đức Phật nói – “Này các Tỷ-kheo, có những” v.v... Ở đây, aparantakappikā (những người chấp thủ về phần sau của kiếp) là những người nắm giữ aparanta (phần sau) được tính là phần cuối của tương lai, hoặc aparantakappa (phần sau của kiếp) là của những người này. Như vậy, phần còn lại cũng nên được hiểu theo cách thức đã nói trước đó.
74. Evaṃ aṭṭhārasa pubbantakappike dassetvā idāni catucattārīsaṃ aparantakappike dassetuṃ – ‘‘santi, bhikkhave’’tiādimāha. Tattha anāgatakoṭṭhāsasaṅkhātaṃ aparantaṃ kappetvā gaṇhantīti aparantakappikā, aparantakappo vā etesaṃ atthīti aparantakappikā. Evaṃ sesampi pubbe vuttappakāranayeneva veditabbaṃ.
Discourse on the View of Percipient
Giải thích về luận chấp Hữu tưởng
Saññīvādavaṇṇanā
75. "Uddhamāghātanikā" means death is called the striking, those who declare the self as being subject to death after are "Uddhamāghātanikā". The view that arises, that is "percipient", the percipient-view, that is in them, thus they are "percipient-view-ists".
75. Uddhamāghātanikā (những người chấp thủ về sự tồn tại sau khi chết) là những người chủ trương linh hồn tồn tại sau khi chết (āghātanaṃ gọi là sự chết). Saññīvāda (luận chấp hữu tưởng) là luận thuyết được khởi lên là hữu tưởng, saññīvādā (những người chấp thủ hữu tưởng) là những người có luận thuyết đó.
75.Uddhamāghātanikāti āghātanaṃ vuccati maraṇaṃ, uddhamāghātanā attānaṃ vadantīti uddhamāghātanikā. Saññīti pavatto vādo, saññīvādo, so etesaṃ atthīti saññīvādā.
76-77. In "material self" and so on, taking the device-form as "self" and the perception that has arisen there as "perception" or, just through speculation, like the Ājīvakas and others, they assert of it "the self is material, undiseased after death, percipient". There, "undiseased" means eternal. Taking the attainment-sign of the immaterial as "self" and the attainment-perception as "perception", or just through speculation, like the Nigaṇṭhas and others, they assert of it "the self is immaterial, undiseased after death, percipient". The third are views that have arisen through a mixed grasping. The fourth are through grasping by speculation alone. The second set of four should be understood in the same way as stated in the discourse on the finite-and-infinite. In the third set of four, it should be understood as one-percipient by way of attainment, manifold-percipient by way of non-attainment, limited-percipient by way of the limited device, immeasurable-percipient by way of the expansive device. In the fourth set of four, seeing with the divine eye beings being reborn in the three-fold and four-fold jhāna planes, one grasps "exclusively happy". Seeing beings being reborn in hell, one grasps "exclusively unhappy". Seeing beings being reborn among humans, one grasps "happy-unhappy". Seeing beings being reborn among the Vehapphala gods, one grasps "neither-unhappy-nor-happy". Indeed, specifically, those with the ability to recollect past lives are speculators about the past, those with the divine eye are speculators about the future.
76-77. Trong câu Rūpī attā (linh hồn có sắc) v.v..., nắm giữ sắc biến xứ là “linh hồn”, tưởng khởi lên ở đó là “tưởng” của linh hồn đó, hoặc chỉ bằng suy lý như những người lõa thể (Ājīvaka) v.v..., tuyên bố về linh hồn đó rằng “linh hồn có sắc, không bệnh, hữu tưởng sau khi chết”. Ở đây, arogo (không bệnh) nghĩa là thường còn. Hoặc nắm giữ tướng của vô sắc định là “linh hồn”, tưởng của định đó là “tưởng” của linh hồn đó, hoặc chỉ bằng suy lý như những người Ni-kiền-tử (Nigaṇṭha) v.v..., tuyên bố về linh hồn đó rằng “linh hồn vô sắc, không bệnh, hữu tưởng sau khi chết”. Thứ ba là tà kiến khởi lên do sự nắm giữ hỗn hợp. Thứ tư là do sự nắm giữ bằng suy lý. Bốn loại thứ hai nên được hiểu theo cách thức đã nói trong luận chấp về hữu biên và vô biên. Trong bốn loại thứ ba, nên hiểu là tưởng đồng nhất do đã chứng đắc, tưởng khác biệt do chưa chứng đắc, tưởng hữu lượng do biến xứ hữu lượng, tưởng vô lượng do biến xứ rộng lớn. Nhưng trong bốn loại thứ tư, với thiên nhãn thấy sự sinh khởi trong ba cõi và bốn cõi thiền, nên nắm giữ là “hoàn toàn an lạc”. Thấy sự sinh khởi trong địa ngục, nên nắm giữ là “hoàn toàn khổ”. Thấy sự sinh khởi trong loài người, nên nắm giữ là “có lạc có khổ”. Thấy sự sinh khởi trong chư thiên cõi Quảng Quả (Vehapphala), nên nắm giữ là “phi khổ phi lạc”. Đặc biệt, những người có túc mạng minh là những người chấp thủ về phần đầu của kiếp, những người có thiên nhãn là những người chấp thủ về phần sau của kiếp.
76-77.Rūpī attātiādīsu kasiṇarūpaṃ ‘‘attā’’ti tattha pavattasaññañcassa ‘‘saññā’’ti gahetvā vā ājīvakādayo viya takkamatteneva vā ‘‘rūpī attā hoti, arogo paraṃ maraṇā saññī’’ti naṃ paññapenti. Tattha arogoti nicco. Arūpasamāpattinimittaṃ pana ‘‘attā’’ti samāpattisaññañcassa ‘‘saññā’’ti gahetvā vā nigaṇṭhādayo viya takkamatteneva vā ‘‘arūpī attā hoti, arogo paraṃ maraṇā saññī’’ti naṃ paññapenti. Tatiyā pana missakagāhavasena pavattā diṭṭhi. Catutthā takkagāheneva. Dutiyacatukkaṃ antānantikavāde vuttanayeneva veditabbaṃ. Tatiyacatukke samāpannakavasena ekattasaññī , asamāpannakavasena nānattasaññī, parittakasiṇavasena parittasaññī, vipulakasiṇavasena appamāṇasaññīti veditabbā. Catutthacatukke pana dibbena cakkhunā tikacatukkajjhānabhūmiyaṃ nibbattamānaṃ disvā ‘‘ekantasukhī’’ti gaṇhāti. Niraye nibbattamānaṃ disvā ‘‘ekantadukkhī’’ti. Manussesu nibbattamānaṃ disvā ‘‘sukhadukkhī’’ti. Vehapphaladevesu nibbattamānaṃ disvā ‘‘adukkhamasukhī’’ti gaṇhāti. Visesato hi pubbenivāsānussatiñāṇalābhino pubbantakappikā honti, dibbacakkhukā aparantakappikāti.
Discourse on the View of Non-Percipient
Giải thích về luận chấp Vô tưởng
Asaññīvādavaṇṇanā
78-83. The view of unconsciousness should be understood in terms of the two sets of four stated at the beginning of the views of consciousness. Similarly, the view of neither-consciousness-nor-unconsciousness. However, for those who grasp that "the self is conscious," those are their views, here it is either "unconscious" or "neither-conscious-nor-unconscious." There, one should not seek a cause in an absolute way. For it has been said that the grasp of one gone to views is like that of a madman on the loose.
78-83. Về luận điểm “hữu tưởng”, “vô tưởng”, cần hiểu theo cách của hai nhóm bốn như đã nói ở đầu. Tương tự như vậy với “phi tưởng phi phi tưởng”. Chỉ có điều, ở kia, những kiến chấp đó là của những người chấp “tự ngã là hữu tưởng”, ở đây là chấp “vô tưởng” và “phi tưởng phi phi tưởng”. Ở đây, không nên tìm kiếm nguyên nhân một cách tuyệt đối. Điều này đã được nói đến, rằng sự chấp thủ của người có tà kiến thì giống như người điên.
78-83. Asaññīvādo saññīvāde ādimhi vuttānaṃ dvinnaṃ catukkānaṃ vasena veditabbo. Tathā nevasaññīnāsaññīvādo. Kevalañhi tattha ‘‘saññī attā’’ti gaṇhantānaṃ tā diṭṭhiyo, idha ‘‘asaññī’’ti ca ‘‘nevasaññīnāsaññī’’ti ca. Tattha na ekantena kāraṇaṃ pariyesitabbaṃ. Diṭṭhigatikassa hi gāho ummattakapacchisadisoti vuttametaṃ.
Description of Annihilationism
**Giải thích về Đoạn Kiến**
Ucchedavādavaṇṇanā
84. In the view of annihilation, "existing" means that which is present. "They cut off" means severance. "They disappear" means not seeing. "They cease to be" means the cessation of existence. All these are just synonyms for each other. Here, two kinds of people grasp the view of annihilation, those who have attained and those who have not attained. Those who have attained, through the divine eye of the Worthy One, seeing passing away, but not seeing rebirth, or those who can only see passing away, but not rebirth; they grasp the view of annihilation. Those who have not attained grasp annihilation either due to being greedy for sensual pleasures thinking, "Who does not know the world beyond?", or based on reasoning, "Just as leaves fallen from a tree do not grow again, so too with beings", and so on. But here, it should be understood that these seven views arise only after variously speculating according to craving and views, in this way and that.
84. Trong đoạn kiến, "hiện hữu" là đang có mặt. "Đoạn" là sự đứt đoạn. "Diệt" là không còn thấy. "Tiêu vong" là sự chấm dứt của hiện hữu. Tất cả những từ này đều là từ đồng nghĩa. Ở đây, có hai hạng người chấp vào đoạn kiến, đó là người có chứng đắc và người không có chứng đắc. Người có chứng đắc, với thiên nhãn thanh tịnh, thấy sự chết mà không thấy sự tái sinh, hoặc người chỉ có thể thấy sự chết mà không thể thấy sự sinh; người ấy chấp vào đoạn kiến. Còn người không có chứng đắc thì hoặc do tham đắm dục lạc mà cho rằng "Ai biết được đời sau", hoặc do suy luận rằng "Như lá rụng từ cây không mọc lại, chúng sinh cũng vậy" mà chấp vào đoạn kiến. Ở đây, cần phải hiểu rằng bảy kiến chấp này sinh khởi do phân biệt theo tham ái và tà kiến, theo cách này hay cách khác.
84. Ucchedavāde satoti vijjamānassa. Ucchedanti upacchedaṃ . Vināsanti adassanaṃ. Vibhavanti bhāvavigamaṃ. Sabbānetāni aññamaññavevacanāneva. Tattha dve janā ucchedadiṭṭhiṃ gaṇhanti, lābhī ca alābhī ca. Lābhī arahato dibbena cakkhunā cutiṃ disvā upapattiṃ apassanto, yo vā cutimattameva daṭṭhuṃ sakkoti, na upapātaṃ; so ucchedadiṭṭhiṃ gaṇhāti. Alābhī ca ‘‘ko paralokaṃ na jānātī’’ti kāmasukhagiddhatāya vā. ‘‘Yathā rukkhato paṇṇāni patitāni na puna viruhanti, evameva sattā’’tiādinā takkena vā ucchedaṃ gaṇhāti. Idha pana taṇhādiṭṭhīnaṃ vasena tathā ca aññathā ca vikappetvāva imā satta diṭṭhiyo uppannāti veditabbā.
85. There, "corporeal" means having form. "Made of the four great elements" means comprised of the four great elements. "Of parents" means belonging to mother and father. What is that? Semen and blood. "Born and originated from mother and father" means arisen due to mother and father. Thus, with the body of form as the head, he speaks of the human state as "self." "In this way, some" means in this way some, indeed.
85. Ở đây, "hữu sắc" là có sắc. "Do bốn đại tạo thành" là do bốn đại hợp thành. "Từ cha mẹ sinh" là do cha mẹ. Cái gì vậy? Tinh cha huyết mẹ. Sinh ra từ cha mẹ là được sinh ra, được hình thành từ cha mẹ. Như vậy, lấy thân thể vật chất làm đầu, nói "tự ngã" là trạng thái làm người. "Như thế này" nghĩa là một số người như vậy.
85. Tattha rūpīti rūpavā. Cātumahābhūtikoti catumahābhūtamayo. Mātāpitūnaṃ etanti mātāpettikaṃ. Kiṃ taṃ? Sukkasoṇitaṃ. Mātāpettike sambhūto jātoti mātāpettikasambhavo. Iti rūpakāyasīsena manussattabhāvaṃ ‘‘attā’’ti vadati. Ittheketi itthaṃ eke evameketi attho.
86. Another, rejecting that, speaks of the divine state. "Divine" means arisen in the deva world. "Belonging to the sense-sphere" means included within the six sense-sphere deva realms. He eats solid food means he partakes of edible food.
86. Người thứ hai bác bỏ điều đó và nói về trạng thái chư thiên. "Thiên giới" là sinh ra ở cõi trời. "Thuộc dục giới" là thuộc sáu cõi trời dục giới. "Thọ dụng vật thực" là ăn vật thực.
86. Dutiyo taṃ paṭikkhipitvā dibbattabhāvaṃ vadati. Dibboti devaloke sambhūto. Kāmāvacaroti cha kāmāvacaradevapariyāpanno. Kabaḷīkāraṃ āhāraṃ bhakkhatīti kabaḷīkārāhārabhakkho.
87. "Mind-made" means created by the mind of jhana. "Complete in all limbs and faculties" means endowed with all limbs and faculties. "With faculties not deficient" means with perfect faculties. This is spoken with reference to what exists in the Brahma-world and with reference to the constitution of others.
87. "Do ý tạo" là được hình thành bởi thiền ý. "Đầy đủ các chi phần" là có đủ các chi phần. "Không thiếu sót các căn" là các căn đầy đủ. Điều này được nói đến theo những gì có ở phạm thiên giới, và theo hình dáng của những cõi khác.
87.Manomayoti jhānamanena nibbatto. Sabbaṅgapaccaṅgīti sabbaṅgapaccaṅgayutto. Ahīnindriyoti paripuṇṇindriyo. Yāni brahmaloke atthi, tesaṃ vasena itaresañca saṇṭhānavasenetaṃ vuttaṃ.
88-92. The meaning of "By completely transcending perceptions of form," etc., has been stated in the Path of Purification. But in "attaining to the base of the infinity of space," and so on, the meaning should be understood as attaining to the state of the base of the infinity of space. The rest here is, indeed, straightforward.
88-92. Ý nghĩa của "vượt qua mọi sắc tưởng" v.v... đã được nói trong Thanh Tịnh Đạo. Còn "sinh vào không vô biên xứ", v.v..., thì cần hiểu nghĩa là: sinh vào cõi không vô biên xứ. Ở đây, còn lại là nghĩa hiển nhiên.
88-92.Sabbaso rūpasaññānaṃ samatikkamātiādīnaṃ attho visuddhimagge vutto. Ākāsānañcāyatanūpagotiādīsu pana ākāsānañcāyatanabhavaṃ upagatoti, evamattho veditabbo. Sesamettha uttānamevāti.
Description of the View of Nibbana in the Present Life
**Giải thích về Niết Bàn Hiện Tại**
Diṭṭhadhammanibbānavādavaṇṇanā
93. In the view of Nibbana in the present life, "present life" refers to direct experience, this term indicates the state attained here and there. Nibbana in the present life is Nibbana in the present life, meaning the cessation of suffering in this very existence. Those who say this are those who hold to the view of Nibbana in the present life. The highest Nibbana in the present life means the supreme Nibbana in the present life, it is the best.
93. Trong Niết bàn hiện tại, "hiện tại" được gọi là pháp trực nghiệm, đây là tên gọi của trạng thái chứng đắc ở nơi đó. Niết bàn trong hiện tại là Niết bàn hiện tại, nghĩa là sự chấm dứt khổ đau ngay trong thân này. Những người nói như vậy là những người chủ trương Niết Bàn Hiện Tại. Niết Bàn Hiện Tại Tối Thượng, nghĩa là Niết Bàn Hiện Tại cao nhất, tối thượng.
93. Diṭṭhadhammanibbānavāde diṭṭhadhammoti paccakkhadhammo vuccati, tattha tattha paṭiladdhattabhāvassetaṃ adhivacanaṃ. Diṭṭhadhamme nibbānaṃ diṭṭhadhammanibbānaṃ, imasmiṃyeva attabhāve dukkhavūpasamananti attho. Taṃ vadantīti diṭṭhadhammanibbānavādā. Paramadiṭṭhadhammanibbānanti paramaṃ diṭṭhadhammanibbānaṃ uttamanti attho.
94. "By the five strands of sense pleasure" means by the five strands of sense objects, such as pleasant forms, or by their fetters. "Endowed" means fully endowed, attached. "Possessed" means completely provided with. "Enjoying" means he indulges, directs, and drives his faculties here and there to those sensual pleasures, according to his pleasure. Or, he sports, plays, rejoices. And here, there are two kinds of sensual pleasures - human and divine. Human ones should be regarded as similar to the sensual pleasures of Mandhātā, divine ones as similar to the sensual pleasures of the deva king who rules over what is created by others. For those who have attained such pleasures, they proclaim the attainment of Nibbana in the present life.
94. "Với năm dục trưởng dưỡng" là với năm phần dục, các đối tượng khả ái, sắc, v.v..., hoặc các sự trói buộc. "Được phú cho" là được phú cho đầy đủ, dính mắc vào. "Được thành tựu" là được đầy đủ. "Thọ hưởng" là vận hành, sử dụng các căn một cách thoải mái trong những dục trưởng dưỡng đó, và đưa chúng đến nơi này nơi kia. Hoặc là vui chơi, đùa giỡn. Và ở đây có hai loại dục trưởng dưỡng - của người và của trời. Dục trưởng dưỡng của người cần được xem là giống như dục trưởng dưỡng của vua Chuyển Luân Thánh Vương, dục trưởng dưỡng của trời giống như dục trưởng dưỡng của vua trời Tha Hóa Tự Tại Thiên. Với những người đạt được những dục lạc như vậy, họ tuyên bố thành tựu Niết Bàn Hiện Tại.
94.Pañcahi kāmaguṇehīti manāpiyarūpādīhi pañcahi kāmakoṭṭhāsehi bandhanehi vā. Samappitoti suṭṭhu appito allīno hutvā. Samaṅgībhūtoti samannāgato. Paricāretīti tesu kāmaguṇesu yathāsukhaṃ indriyāni cāreti sañcāreti itocito ca upaneti. Atha vā laḷati ramati kīḷati. Ettha ca duvidhā kāmaguṇā – mānusakā ceva dibbā ca. Mānusakā mandhātukāmaguṇasadisā daṭṭhabbā, dibbā paranimmitavasavattidevarājassa kāmaguṇasadisāti. Evarūpe kāme upagatānañhi te diṭṭhadhammanibbānasampattiṃ paññapenti.
95. In the second case, they should be understood as impermanent in the sense of becoming after having been, painful in the sense of oppression, subject to change in the sense of abandoning their nature. "Due to their changing and altering" means the altering which is the changing of those pleasures, that which was mine, that is no longer mine, according to the stated method, grief, lamentation, pain, displeasure and despair arise. There, grief has the characteristic of inward burning, lamentation has the characteristic of wailing based on that, pain has the characteristic of bodily oppression, displeasure has the characteristic of mental disturbance, despair has the characteristic of dejection, the meaning of "apart from sensual pleasures," etc. has been spoken of in the Path of Purification.
95. Lần thứ hai, cần hiểu là vô thường theo nghĩa là có rồi không, khổ theo nghĩa là bị bức bách, biến hoại theo nghĩa là bản chất bị thay đổi. Sự biến hoại, biến đổi của chúng, sự biến đổi của những dục lạc đó được gọi là biến hoại, sầu, bi, khổ, ưu, não khởi lên theo cách đã nói "cái mà ta đã có, nay ta không còn". Ở đây, sầu có tướng trạng thiêu đốt bên trong, bi có tướng trạng than khóc do sầu, khổ có tướng trạng bức bách thân thể, ưu có tướng trạng làm tâm suy sụp, não có tướng trạng sầu muộn, ý nghĩa của "rời bỏ dục" v.v... đã được nói trong Thanh Tịnh Đạo.
95. Dutiyavāre hutvā abhāvaṭṭhena aniccā paṭipīḷanaṭṭhena dukkhā, pakatijahanaṭṭhena vipariṇāmadhammāti veditabbā. Tesaṃ vipariṇāmaññathābhāvāti tesaṃ kāmānaṃ vipariṇāmasaṅkhātā aññathābhāvā, yampi me ahosi, tampi me natthīti vuttanayena uppajjanti sokaparidevadukkhadomanassupāyāsā. Tattha antonijjhāyanalakkhaṇo soko, tannissitalālappanalakkhaṇo paridevo, kāyappaṭipīḷanalakkhaṇaṃ dukkhaṃ, manovighātalakkhaṇaṃ domanassaṃ, visādalakkhaṇo upāyāso, vivicceva kāmehītiādīnamattho visuddhimagge vutto.
96. "Applied thought" is applied thought functioning by placing. "Sustained thought" is sustained thought functioning by examining. "This" means by this applied thought and sustained thought, this first jhana seems gross like something with a thorn.
96. "Có tầm" là tầm khởi lên do tác ý hướng tâm. "Có tứ" là tứ khởi lên do tác ý duy trì. "Do cái này" là do tầm và tứ này, sơ thiền này thô, như có gai.
96.Vitakkitanti abhiniropanavasena pavatto vitakko. Vicāritanti anumajjanavasena pavatto vicāro. Etenetanti etena vitakkitena ca vicāritena ca etaṃ paṭhamajjhānaṃ oḷārikaṃ sakaṇḍakaṃ viya khāyati.
97-98. "Rapture-pervaded" means just rapture. "Making the mind float" means causing the mind to float. "Mental absorption" means after emerging from jhana, the mind's repeated absorption, consideration, and reviewing of that happiness. The rest here, in the view of Nibbana in the present life, is straightforward.
97-98. "Thuộc về hỷ" chính là hỷ. "Làm tâm phấn chấn" là làm cho tâm hưng phấn. "Tác ý tâm" là sau khi xuất thiền, sự tác ý, sự chú tâm, sự hướng tâm đến lạc đó lặp đi lặp lại. Còn lại trong Niết Bàn Hiện Tại ở đây là nghĩa hiển nhiên.
97-98.Pītigatanti pītiyeva. Cetaso uppilāvitattanti cittassa uppilabhāvakaraṇaṃ. Cetaso ābhogoti jhānā vuṭṭhāya tasmiṃ sukhe punappunaṃ cittassa ābhogo manasikāro samannāhāroti. Sesamettha diṭṭhadhammanibbānavāde uttānameva.
In this way, all sixty-two views have been spoken of. Of which, there are seven views of annihilation, the rest are eternalist views.
Như vậy, tất cả sáu mươi hai tà kiến đã được nói đến. Trong đó, có bảy đoạn kiến, còn lại là thường kiến.
Ettāvatā sabbāpi dvāsaṭṭhidiṭṭhiyo kathitā honti. Yāsaṃ satteva ucchedadiṭṭhiyo, sesā sassatadiṭṭhiyo.
100-104. Now, by this section "these, indeed, bhikkhus," all those belonging to the future are brought together and the knowledge of omniscience is released. Again, by the section beginning "these, indeed, bhikkhus," all those belonging to the past and the future are brought together and that very knowledge is released. Thus, even when questioned "what, indeed, bhikkhus, are those things," etc., it is the knowledge of omniscience that is questioned, and even when releasing, weighing the inclinations of beings, as if extracting a grain of sand from Mount Sineru, extracting the sixty-two views, it is the knowledge of omniscience that is released. Thus, this discourse has come by way of tracing the links.
100-104. Bây giờ, – "Này các Tỳ kheo, với những pháp này" bằng đoạn này, tóm thâu tất cả những người chấp vào vị lai, Ngài đưa ra tri kiến toàn giác. Lại nữa, – "Này các Tỳ kheo, với những pháp này" bằng đoạn này, tóm thâu tất cả những người chấp vào quá khứ và vị lai, Ngài đưa ra chính tri kiến đó. Như vậy, "Này các Tỳ kheo, những pháp này là gì?", dù được hỏi, Ngài chỉ hỏi về tri kiến toàn giác, và khi trả lời, Ngài cũng như cân nhắc khuynh hướng của chúng sinh, như lấy cát từ núi Tu Di, Ngài rút ra sáu mươi hai tà kiến, rồi đưa ra tri kiến toàn giác. Như vậy, bài kinh này được trình bày theo nhân duyên.
100-104. Idāni – ‘‘imehi kho te, bhikkhave’’ti iminā vārena sabbepi te aparantakappike ekajjhaṃ niyyātetvā sabbaññutaññāṇaṃ vissajjeti. Puna – ‘‘imehi, kho te bhikkhave’’tiādinā vārena sabbepi te pubbantāparantakappike ekajjhaṃ niyyātetvā tadeva ñāṇaṃ vissajjeti. Iti ‘‘katame ca te, bhikkhave, dhammā’’tiādimhi pucchamānopi sabbaññutaññāṇameva pucchitvā vissajjamānopi sattānaṃ ajjhāsayaṃ tulāya tulayanto viya sinerupādato vālukaṃ uddharanto viya dvāsaṭṭhi diṭṭhigatāni uddharitvā sabbaññutaññāṇameva vissajjeti. Evamayaṃ yathānusandhivasena desanā āgatā.
For there are three links of the discourse - the link of questioning, the link of inclination, and the link of tracing. There, the link of questioning should be understood based on the discourse that the Blessed One gave in reply to those who asked thus: "having spoken thus, a certain bhikkhu said this to the Blessed One: 'What, indeed, venerable sir, is the near shore, what is the far shore, who is sinking in the middle, who is standing on dry land, who is the human-snatcher, who is the non-human-snatcher, who is the whirlpool-snatcher, who is inwardly putrid?'" (Samyutta Nikaya 4.241).
Có ba nhân duyên của bài kinh – nhân duyên câu hỏi, nhân duyên khuynh hướng, và nhân duyên pháp. Ở đây, "Khi nói như vậy, một Tỳ kheo bạch Thế Tôn: 'Bạch Thế Tôn, bờ bên kia là gì, bờ bên này là gì, cái gì chìm ở giữa, cái gì nổi trên cạn, cái gì bị người bắt, cái gì bị phi nhân bắt, cái gì bị xoáy nước bắt, cái gì hư hoại từ bên trong?'" (Tương Ưng Bộ Kinh, IV.241) Cần phải hiểu nhân duyên câu hỏi theo bài kinh được Thế Tôn trả lời cho những câu hỏi như vậy.
Tayo hi suttassa anusandhī – pucchānusandhi, ajjhāsayānusandhi, yathānusandhīti. Tattha ‘‘evaṃ vutte aññataro bhikkhu bhagavantaṃ etadavoca – kiṃ nu kho, bhante, orimaṃ tīraṃ, kiṃ pārimaṃ tīraṃ, ko majjhe saṃsīdo, ko thale ussādo, ko manussaggāho, ko amanussaggāho, ko āvaṭṭaggāho, ko antopūtibhāvo’’ti (saṃ. ni. 4.241) evaṃ pucchantānaṃ bhagavatā vissajjitasuttavasena pucchānusandhi veditabbo.
Then, to a certain bhikkhu, this reflection arose in his mind: "so, indeed, alas, form is not-self... feeling... perception... formations... consciousness is not-self, deeds done by what is not-self, alas, will experience the results of what is self." Then the Blessed One, knowing with his mind the reflection in that bhikkhu's mind, addressed the bhikkhus: "There is, indeed, bhikkhus, a situation where a certain foolish man, ignorant, overcome by ignorance, with a mind dominated by craving, might think to go beyond the Teacher's teaching: 'so, indeed, alas, form is not-self... etc. ... will experience the results'. What do you think, bhikkhus, is form permanent or impermanent?" (Majjhima Nikaya 3.10). Thus, knowing the inclinations of others, the link of inclination should be understood based on the discourse spoken by the Blessed One.
Một Tỳ kheo khác có suy nghĩ như sau: – 'Như vậy, này chư vị, sắc là vô ngã…, thọ…, tưởng…, hành…, thức là vô ngã, nghiệp do vô ngã tạo ra, làm sao có thể xúc chạm tự ngã?' Rồi Thế Tôn, với tâm của mình biết được suy nghĩ của vị Tỳ kheo đó, liền bảo các Tỳ kheo: – 'Này các Tỳ kheo, có trường hợp này, ở đây, có một kẻ ngu si, không có trí tuệ, bị vô minh chi phối, với tâm bị tham ái dẫn dắt, có thể nghĩ rằng vượt qua lời dạy của bậc Đạo Sư – 'Như vậy, này chư vị, sắc là vô ngã… xúc chạm?' Các người nghĩ thế nào, này các Tỳ kheo, sắc là thường hay vô thường?'" (Trung Bộ Kinh, III.10). Cần phải hiểu nhân duyên khuynh hướng theo bài kinh được Thế Tôn nói sau khi biết khuynh hướng của người khác như vậy.
Atha kho aññatarassa bhikkhuno evaṃ cetaso parivitakko udapādi – ‘‘iti kira bho rūpaṃ anattā…, vedanā…, saññā…, saṅkhārā …, viññāṇaṃ anattā, anattakatāni kira kammāni kamattānaṃ phusissantī’’ti. Atha kho bhagavā tassa bhikkhuno cetasā ceto parivitakkamaññāya bhikkhū āmantesi – ‘‘ṭhānaṃ kho panetaṃ, bhikkhave, vijjati, yaṃ idhekacco moghapuriso avidvā avijjāgato taṇhādhipateyyena cetasā satthusāsanaṃ atidhāvitabbaṃ maññeyya – ‘‘iti kira bho rūpaṃ anattā…pe… phusissantī’’ti. Taṃ kiṃ maññatha, bhikkhave, rūpaṃ niccaṃ vā aniccaṃ vā’’ti (ma. ni. 3.10). Evaṃ paresaṃ ajjhāsayaṃ viditvā bhagavatā vuttasuttavasena ajjhāsayānusandhi veditabbo.
But, in those discourses where the teaching above arises according to the thing with which the teaching arose at the beginning, either by way of a thing similar to that thing or by way of its opposite, their method should be understood as tracing the links. For example, in the Discourse on Wishing, the teaching below arose with morality, above, the six super-knowledges came. In the Discourse on the Simile of the Cloth, the teaching below arose with defilement, above, the divine abidings came. In the Kosambaka Sutta, the teaching below arose with quarreling, above, the principles of cordiality came. In the Discourse on the Simile of the Saw, the teaching below arose with non-forbearance, above, the simile of the saw came. Also in this Net of Perfect Wisdom, the teaching below arose with views, above, the elucidation of emptiness came. Therefore it has been said, "Thus this discourse has come by way of tracing the links."
Còn nhân duyên pháp cần hiểu theo những bài kinh mà trong đó, bài giảng tiếp theo xuất hiện, theo pháp tương ứng hoặc theo pháp đối nghịch với pháp mà bài giảng ban đầu được khởi lên. Ví dụ như, trong kinh Ước Nguyện (Ākaṅkheyya), bài giảng bắt đầu với giới, tiếp theo là sáu thắng trí. Trong kinh Ví Dụ Tấm Vải (Vattha), bài giảng bắt đầu với phiền não, tiếp theo là tứ vô lượng tâm. Trong kinh Kosambaka, bài giảng bắt đầu với tranh cãi, tiếp theo là pháp hòa hợp. Trong kinh Ví Dụ Cái Cưa (Kakacūpama), bài giảng bắt đầu với bất nhẫn, tiếp theo là ví dụ cái cưa. Trong kinh Phạm Võng (Brahmajāla) này, bài giảng bắt đầu với tà kiến, tiếp theo là sự hiển lộ tánh không. Vì vậy, nói rằng – "Như vậy, bài kinh này được trình bày theo nhân duyên pháp."
Yena pana dhammena ādimhi desanā uṭṭhitā, tassa dhammassa anurūpadhammavasena vā paṭipakkhavasena vā yesu suttesu upari desanā āgacchati, tesaṃ vasena yathānusandhi veditabbo. Seyyathidaṃ, ākaṅkheyyasutte heṭṭhā sīlena desanā uṭṭhitā, upari cha abhiññā āgatā. Vatthasutte heṭṭhā kilesena desanā uṭṭhitā, upari brahmavihārā āgatā. Kosambakasutte heṭṭhā bhaṇḍanena uṭṭhitā, upari sāraṇīyadhammā āgatā. Kakacūpame heṭṭhā akkhantiyā uṭṭhitā, upari kakacūpamā āgatā. Imasmimpi brahmajāle heṭṭhā diṭṭhivasena desanā uṭṭhitā, upari suññatāpakāsanaṃ āgataṃ. Tena vuttaṃ – ‘‘evamayaṃ yathānusandhivasena desanā āgatā’’ti.
Description of the Passage on Agitation and Vacillation
**Giải thích về Đoạn Dao Động, Bức Bách**
Paritassitavipphanditavāravaṇṇanā
105-117. Now, for the sake of showing the division of boundaries, the teaching beginning with "There, bhikkhus," etc. has been commenced. "Also that of those venerable recluses and brahmins who do not know, do not see, is an experienced state of those gone to craving, only an agitation and vacillation" means that by the enjoyment of views, by the pleasure of views, by the experienced state of views with which they, being born with pleasant feelings, proclaim the eternal self and the world by four bases, also that of those venerable recluses and brahmins who do not know, do not see the true nature of things as they really are, is an experienced state of those gone to craving, only that experienced state is only of those gone to craving, and that, indeed, is only an agitation and vacillation. He shows that it is only an agitation and vacillation due to the agitation which is views and the agitation which is craving, it is only swayed, only shaken, like a stake driven into a heap of chaff, not steadfast like the vision of a stream-enterer. This method applies also to the partial-eternalists, and so on.
105-117. Bây giờ, để chỉ rõ sự phân chia giới hạn, bài giảng bắt đầu với "Ở đây, này các Tỳ kheo". Điều đó, đối với những vị Sa-môn, Bà-la-môn không biết, không thấy sự thật về các pháp, đối với họ, là sự cảm thọ của tham ái, là sự dao động, bức bách mà thôi. Với vị ngọt của tà kiến, với lạc của tà kiến, với cảm thọ của tà kiến, những vị ấy khởi lên hỷ lạc, tuyên bố tự ngã và thế giới là thường còn với bốn trường hợp, điều đó, đối với những vị Sa-môn, Bà-la-môn không biết, không thấy như thật bản chất của các pháp, đối với họ, là sự cảm thọ của tham ái, chỉ là sự cảm thọ của tham ái mà thôi, và điều đó, quả thật, là sự dao động, bức bách mà thôi. Ngài chỉ ra rằng đó là sự dao động, xao động, chấn động bởi sự bức bách của tà kiến và tham ái, giống như cọc đóng vào đống trấu, không vững chắc như tri kiến của bậc Dự Lưu. Cách giải thích này cũng tương tự đối với những người chấp vào một phần thường còn, v.v...
105-117. Idāni mariyādavibhāgadassanatthaṃ – ‘‘tatra bhikkhave’’tiādikā desanā āraddhā. Tadapi tesaṃ bhavataṃ samaṇabrāhmaṇānaṃ ajānataṃ apassataṃ vedayitaṃ taṇhāgatānaṃ paritassitavipphanditamevāti yena diṭṭhiassādena diṭṭhisukhena diṭṭhivedayitena te somanassajātā sassataṃ attānañca lokañca paññapenti catūhi vatthūhi, tadapi tesaṃ bhavantānaṃ samaṇabrāhmaṇānaṃ yathābhūtaṃ dhammānaṃ sabhāvaṃ ajānantānaṃ apassantānaṃ vedayitaṃ taṇhāgatānaṃ kevalaṃ taṇhāgatānaṃyeva taṃ vedayitaṃ, tañca kho panetaṃ paritassitavipphanditameva. Diṭṭhisaṅkhātena ceva taṇhāsaṅkhātena ca paritassitena vipphanditameva calitameva kampitameva thusarāsimhi nikhātakhāṇusadisaṃ, na sotāpannassa dassanamiva niccalanti dasseti. Esa nayo ekaccasassatavādādīsupi.
Description of the Passage on Contact as a Condition
**Giải thích về Đoạn Xúc**
Phassapaccayavāravaṇṇanā
118-130. Again - "Therein, monks, those ascetics and brahmins who are eternalists" and so on, was begun in order to show the sequential conditionality. Therein, "even that is conditioned by contact," by that enjoyment of views, pleasure of views, feeling caused by views, with which those experiencing the joy of becoming, proclaim the self and the world to be eternal, with four bases, even that feeling which is agitated by craving and views is conditioned by contact, he shows. This method applies everywhere.
118-130. Lại nữa – "Ở đây, này các Tỳ-kheo, những Sa-môn, Bà-la-môn nào là những người chủ trương Thường kiến" v.v... được bắt đầu để chỉ rõ mối liên hệ nhân duyên tuần tự. Ở đây, "cả cái đó cũng do xúc làm duyên" nghĩa là, do sự tham đắm kiến chấp, lạc thú kiến chấp, thọ cảm kiến chấp nào mà những vị ấy sinh khởi tâm hoan hỷ rồi tuyên bố về một tự ngã và thế gian thường còn với bốn trường hợp, thì (Đức Phật) chỉ rõ rằng thọ cảm bị khuấy động bởi tham ái và kiến chấp ấy cũng do xúc làm duyên. Phương pháp này giống nhau trong tất cả các trường hợp.
118-130. Puna – ‘‘tatra, bhikkhave, ye te samaṇabrāhmaṇā sassatavādā’’tiādi paramparapaccayadassanatthaṃ āraddhaṃ . Tattha tadapi phassapaccayāti yena diṭṭhiassādena diṭṭhisukhena diṭṭhivedayitena te somanassajātā sassataṃ attānañca lokañca paññapenti catūhi vatthūhi, tadapi taṇhādiṭṭhipariphanditaṃ vedayitaṃ phassapaccayāti dasseti. Esa nayo sabbattha.
131-143. Now, in order to show the strength of that condition in feeling caused by views, again he said, "Therein, monks, those ascetics and brahmins who are eternalists," and so on. Therein, indeed, without contact, these ascetics and brahmins will experience that feeling, there is no reason for this. Just as a pillar is a strong support for a falling house, it cannot stand without the support of the pillar, in the same way, contact is a strong condition for feeling. Without it, this feeling caused by views does not exist, he shows. This method applies everywhere.
131-143. Giờ đây, để chỉ rõ tính chất mạnh mẽ trong thọ cảm kiến chấp của duyên ấy, Ngài lại nói: "Ở đây, này các Tỳ-kheo, những Sa-môn, Bà-la-môn nào là những người chủ trương Thường kiến" v.v... Ở đây, "những vị ấy, chắc chắn rồi, không có xúc" nghĩa là, không có lý do gì để những Sa-môn, Bà-la-môn ấy có thể cảm nghiệm thọ cảm ấy mà không có xúc. Giống như cây cột là duyên mạnh mẽ để chống đỡ ngôi nhà đang đổ, không có sự chống đỡ của cây cột ấy thì không thể đứng vững, xúc cũng như vậy, là duyên mạnh mẽ cho thọ, không có nó thì thọ cảm kiến chấp này không tồn tại. Phương pháp này giống nhau trong tất cả các trường hợp.
131-143. Idāni tassa paccayassa diṭṭhivedayite balavabhāvadassanatthaṃ puna – ‘‘tatra, bhikkhave, ye te samaṇabrāhmaṇā sassatavādā’’tiādimāha. Tattha te vata aññatra phassāti te vata samaṇabrāhmaṇā taṃ vedayitaṃ vinā phassena paṭisaṃvedissantīti kāraṇametaṃ natthīti. Yathā hi patato gehassa upatthambhanatthāya thūṇā nāma balavapaccayo hoti, na taṃ thūṇāya anupatthambhitaṃ ṭhātuṃ sakkoti, evameva phassopi vedanāya balavapaccayo, taṃ vinā idaṃ diṭṭhivedayitaṃ natthīti dasseti. Esa nayo sabbattha.
Explanation of the discourse on views, standpoints and clinging.
Giải thích về câu chuyện luân hồi của các quan điểm và chấp trước
Diṭṭhigatikādhiṭṭhānavaṭṭakathāvaṇṇanā
144. Now, "Therein, monks, those ascetics and brahmins who are eternalists, proclaim the self and the world to be eternal, with four bases, and those ascetics and brahmins who are partly-eternalists," using this method he summarizes all feelings caused by views. Why? In order to include them under contact later. How so? "All of them experience through the six sense-bases of contact again and again." Here, the six sense-bases of contact are – the sense-base of eye-contact, the sense-base of ear-contact, the sense-base of nose-contact, the sense-base of tongue-contact, the sense-base of body-contact, the sense-base of mind-contact – these are the six. The word sense-base (ayatana) is used in the sense of origin, gathering, cause, and mere designation. Therein – "Kamboja is the sense-base of horses, the Deccan of cattle," it is used in the sense of origin, meaning the place of origin. "In delightful sense-bases, birds resort to them," is used in the sense of gathering. "When there is mindfulness, there is the sense-base of mindfulness," is used in the sense of cause. "In the sense-base of the forest, they agree in leaf-huts," is used in the sense of mere designation. Here, this (word) is appropriately used in all three senses of origin, and so on. For in the eye, and so on, the five aggregates, starting with contact, originate, gather, and they are their cause, thus they are sense-bases. Here, however, "On account of the eye and forms arises eye-consciousness, the meeting of the three is contact," with this method, raising the teaching with contact as its head, in order to show the sequence of conditionality, he spoke of sense-base of contact, and so on.
144. Giờ đây, "Ở đây, này các Tỳ-kheo, những Sa-môn, Bà-la-môn nào là những người chủ trương Thường kiến, tuyên bố về một tự ngã và thế gian thường còn với bốn trường hợp", Ngài tổng hợp tất cả các thọ cảm kiến chấp bằng phương pháp "và những Sa-môn, Bà-la-môn nào là những người chủ trương một phần thường còn" v.v... Vì sao? Để đặt lên trên xúc. Như thế nào? "Tất cả những vị ấy, qua sáu xúc xứ, xúc chạm rồi cảm nghiệm". Ở đây, sáu xúc xứ là – nhãn xúc xứ, nhĩ xúc xứ, tỷ xúc xứ, thiệt xúc xứ, thân xúc xứ, và ý xúc xứ, là sáu cái này. Vì từ "xứ" này được sử dụng trong các nghĩa như: sự sinh khởi, sự tụ hội, nguyên nhân, và chỉ là sự quy ước. Ở đây – "Kamboja (Kiếm-bồ-già, tên một nước) là xứ của các con ngựa, Dakkhināpatha (Đức-kiền-đà-bà-tha, tên một nước) là xứ của bò cái", được sử dụng trong nghĩa sự sinh khởi, nghĩa là nơi sinh khởi. "Trong các xứ khả ái, chim chóc tụ hội", được sử dụng trong nghĩa sự tụ hội. "Khi có xứ của niệm", được sử dụng trong nghĩa nguyên nhân. "Trong các xứ rừng rậm, họ đồng ý trong các túp lều tranh", được sử dụng trong nghĩa chỉ là sự quy ước. Ở đây, nó phù hợp với cả ba nghĩa là sự sinh khởi v.v... Vì trong nhãn v.v..., các pháp năm uẩn (ngũ uẩn) có xúc đứng đầu được sinh khởi, tụ hội, và chúng là nguyên nhân của chúng, nên là các xứ. Nhưng ở đây, "do duyên con mắt và các sắc, nhãn thức khởi lên, sự gặp gỡ của ba (yếu tố) là xúc", với phương pháp này, đưa bài giảng lên đứng đầu là xúc, bắt đầu bằng xúc, để chỉ ra chuỗi nhân duyên, các xúc xứ v.v... được nói đến.
144. Idāni tatra bhikkhave, ye te samaṇabrāhmaṇā sassatavādā sassataṃ attānañca lokañca paññapenti catūhi vatthūhi, yepi te samaṇabrāhmaṇā ekaccasassatikātiādinā nayena sabbadiṭṭhivedayitāni sampiṇḍeti. Kasmā? Upari phasse pakkhipanatthāya. Kathaṃ? Sabbe te chahi phassāyatanehi phussa phussa paṭisaṃvedentīti. Tattha cha phassāyatanāni nāma – cakkhuphassāyatanaṃ, sotaphassāyatanaṃ, ghānaphassāyatanaṃ, jivhāphassāyatanaṃ, kāyaphassāyatanaṃ, manophassāyatananti imāni cha. Sañjāti-samosaraṇa-kāraṇa-paṇṇattimattatthesu hi ayaṃ āyatanasaddo pavattati. Tattha – ‘‘kambojo assānaṃ āyatanaṃ, gunnaṃ dakkhiṇāpatho’’ti sañjātiyaṃ pavattati, sañjātiṭṭhāneti attho. ‘‘Manorame āyatane, sevanti naṃ vihaṅgamā’’ti (a. ni. 5.38) samosaraṇe. ‘‘Sati satiāyatane’’ti (a. ni. 3.102) kāraṇe. ‘‘Araññāyatane paṇṇakuṭīsu sammantī’’ti (saṃ. ni. 1.255) paṇṇattimatte. Svāyamidha sañjātiādiatthattayepi yujjati. Cakkhādīsu hi phassapañcamakā dhammā sañjāyanti samosaranti, tāni ca tesaṃ kāraṇanti āyatanāni. Idha pana ‘‘cakkhuñca paṭicca rūpe ca uppajjati cakkhuviññāṇaṃ, tiṇṇaṃ saṅgati phasso’’ti (saṃ. ni. 2.43) iminā nayena phassasīseneva desanaṃ āropetvā phassaṃ ādiṃ katvā paccayaparamparaṃ dassetuṃ phassāyatanādīni vuttāni.
They experience through repeated contact, means they experience having contacted again and again. Here, although the function of contacting of the sense-bases is mentioned, as it were, yet the function of contacting is not to be understood as belonging to them. For the sense-bases do not contact, only contact contacts each respective object. The sense-bases, however, are shown as included within contact; therefore, all of them, by means of contact arisen from the six sense-bases of contact, having contacted the objects of forms and so on, experience that feeling caused by views, thus the meaning should be understood here.
"Xúc chạm rồi cảm nghiệm" nghĩa là sau khi xúc chạm, xúc chạm rồi cảm nghiệm. Và ở đây, mặc dù hoạt động xúc chạm của các xứ được nói đến như vậy, tuy nhiên, không nên xem đó là hoạt động xúc chạm của chúng. Vì không phải các xứ xúc chạm, mà chính xúc xúc chạm đối tượng tương ứng, các xứ chỉ được chỉ ra sau khi đặt vào trong xúc; do đó, tất cả những vị ấy, sau khi xúc chạm các đối tượng như sắc v.v... bằng xúc sinh ra từ sáu xúc xứ, cảm nghiệm thọ cảm kiến chấp ấy, ý nghĩa ở đây nên được hiểu như vậy.
Phussa phussa paṭisaṃvedentīti phusitvā phusitvā paṭisaṃvedenti. Ettha ca kiñcāpi āyatanānaṃ phusanakiccaṃ viya vuttaṃ, tathāpi na tesaṃ phusanakiccatā veditabbā. Na hi āyatanāni phusanti, phassova taṃ taṃ ārammaṇaṃ phusati, āyatanāni pana phasse upanikkhipitvā dassitāni; tasmā sabbe te cha phassāyatanasambhavena phassena rūpādīni ārammaṇāni phusitvā taṃ diṭṭhivedanaṃ paṭisaṃvedayantīti evamettha attho veditabbo.
Among them, craving is conditioned by feeling, and so on, feeling is the feeling arisen from the six sense-bases of contact. That (feeling) becomes a condition for craving, which is differentiated into craving for forms and so on, in terms of dependency. Therefore, it is said – "Among them, craving is conditioned by feeling." That (craving), in turn, becomes a condition for the four kinds of clinging, in terms of dependency and in terms of co-nascence. Similarly, clinging is for becoming. Becoming is a condition for birth in terms of dependency.
"Thọ là duyên cho ái của họ" v.v..., thọ ở đây là thọ sinh ra từ sáu xúc xứ. Nó là duyên cho ái, được phân biệt thành sắc ái v.v..., bằng phương diện là y chỉ. Do đó, বলা được nói: "Thọ là duyên cho ái của họ". Nhưng ái ấy là duyên cho bốn loại thủ bằng phương diện là y chỉ và bằng phương diện đồng sinh. Cũng như vậy, thủ là duyên cho hữu. Hữu là duyên cho sinh bằng phương diện là y chỉ.
Tesaṃ vedanāpaccayā taṇhātiādīsu vedanāti cha phassāyatanasambhavā vedanā. Sā rūpataṇhādibhedāya taṇhāya upanissayakoṭiyā paccayo hoti. Tena vuttaṃ – ‘‘tesaṃ vedanāpaccayā taṇhā’’ti. Sā pana catubbidhassa upādānassa upanissayakoṭiyā ceva sahajātakoṭiyā ca paccayo hoti. Tathā upādānaṃ bhavassa. Bhavo jātiyā upanissayakoṭiyā paccayo hoti.
Here birth should be understood as the five aggregates with their modifications, birth is a condition for decay and death, and for grief and so on, in terms of dependency. This is the summary here; in detail, however, the discourse on dependent origination is explained in the Path of Purification. Here, however, only its purpose should be understood. The Blessed One, while speaking on the discourse of the round, said "The beginning, monks, is not evident of ignorance; 'Before this, there was no ignorance, but afterwards it came to be' and it is said like this, monks, and yet it is evident 'Ignorance is based on this condition'" thus beginning with ignorance, or "The beginning, monks, is not evident of craving for existence...and so on...'Craving for existence is based on this condition'" thus beginning with craving, or "The beginning, monks, is not evident of view of existence...and so on... 'View of existence is based on this condition'" thus beginning with view. Here, however, beginning with view, having spoken of the views arising due to the delight in feeling, he gave the dependent origination based on feeling. Thereby, he shows this – "Thus, those who are engaged in views, having grasped this view, wandering and transmigrating through the three existences, the four origins, the five destinies, the seven stations of consciousness, the nine abodes of beings, from here to there, from there to here, like a bull yoked to a mill, like a dog tied to a post, or like a ship that has lost its course due to the wind, they just revolve around the suffering of the round, they are unable to raise their heads out of the suffering of the round."
"Sinh" ở đây nên được xem là năm uẩn (ngũ uẩn) cùng với các biến đổi, sinh là duyên cho lão và tử và cho sầu v.v... bằng phương diện là y chỉ. Đây là tóm tắt ở đây, còn chi tiết thì câu chuyện về Duyên khởi được nói trong Thanh Tịnh Đạo. Ở đây, chỉ nên biết mục đích của nó. Vì Đức Thế Tôn, khi giảng về câu chuyện luân hồi – "Này các Tỳ-kheo, khởi điểm không thể nhận biết được của vô minh, ‘trước đây không có vô minh, sau đó nó mới có,’ này các Tỳ-kheo, được nói như vậy, và do đó, được nhận biết ‘do cái này làm duyên, vô minh (hiện hữu),'" như vậy bắt đầu bằng vô minh, hoặc, "Này các Tỳ-kheo, khởi điểm không thể nhận biết được của hữu ái... ‘do cái này làm duyên, hữu ái (hiện hữu),'" như vậy bắt đầu bằng ái, hoặc, "Này các Tỳ-kheo, khởi điểm không thể nhận biết được của hữu kiến... ‘do cái này làm duyên, hữu kiến (hiện hữu),'" như vậy bắt đầu bằng kiến chấp, Ngài đã giảng. Nhưng ở đây, bắt đầu bằng kiến chấp, sau khi giảng về các kiến chấp sinh khởi do tham đắm thọ, Ngài giảng về Duyên khởi bắt nguồn từ thọ. Do đó, điều này chỉ rõ – "Những người theo kiến chấp này là như vậy, chấp nhận quan điểm này, trôi lăn, luân hồi trong ba cõi, bốn loài, năm đường, bảy thức trú, chín hữu xứ, từ đây đến kia, từ kia đến đây, giống như con bò bị cột vào cỗ xe, giống như con chó bị buộc vào cột, và giống như con thuyền bị gió thổi trôi, chúng chỉ xoay vần trong khổ đau luân hồi, không thể ngẩng đầu lên khỏi khổ đau luân hồi".
Jātīti panettha savikārā pañcakkhandhā daṭṭhabbā, jāti jarāmaraṇassa ceva sokādīnañca upanissayakoṭiyā paccayo hoti. Ayamettha saṅkhepo, vitthārato pana paṭiccasamuppādakathā visuddhimagge vuttā. Idha panassa payojanamattameva veditabbaṃ. Bhagavā hi vaṭṭakathaṃ kathento – ‘‘purimā, bhikkhave, koṭi na paññāyati avijjāya, ‘ito pubbe avijjā nāhosi, atha pacchā samabhavī’ti evañcetaṃ, bhikkhave, vuccati, atha ca pana paññāyati ‘‘idappaccayā avijjā’’ti (a. ni. 10.61) evaṃ avijjāsīsena vā, purimā, bhikkhave, koṭi na paññāyati bhavataṇhāya…pe… ‘‘idappaccayā bhavataṇhā’’ti (a. ni. 10.62) evaṃ taṇhāsīsena vā, purimā, bhikkhave, koṭi na paññāyati bhavadiṭṭhiyā…pe… ‘‘idappaccayā bhavadiṭṭhī’’ti evaṃ diṭṭhisīsena vā kathesi’’. Idha pana diṭṭhisīsena kathento vedanārāgena uppajjamānā diṭṭhiyo kathetvā vedanāmūlakaṃ paṭiccasamuppādaṃ kathesi. Tena idaṃ dasseti – ‘‘evamete diṭṭhigatikā, idaṃ dassanaṃ gahetvā tīsu bhavesu catūsu yonīsu pañcasu gatīsu sattasu viññāṇaṭṭhitīsu navasu sattāvāsesu ito ettha etto idhāti sandhāvantā saṃsarantā yante yuttagoṇo viya, thambhe upanibaddhakukkuro viya, vātena vippannaṭṭhanāvā viya ca vaṭṭadukkhameva anuparivattanti, vaṭṭadukkhato sīsaṃ ukkhipituṃ na sakkontī’’ti.
Explanation of the discourse of turning away, etc.
Giải thích về câu chuyện xuất ly v.v...
Vivaṭṭakathādivaṇṇanā
145. Having thus spoken of views, standpoints and the clinging in the round, now, establishing the standpoint of a monk who is engaged in striving, in order to show the turning away, he said – "When, monks, a monk" and so on. Therein, when means at what time. Of the six sense-bases of contact, means, of those same six sense-bases of contact by which, having contacted and experienced, those engaged in views, the round continues, of them, of the six sense-bases of contact. In arising and so on, the arising, and so on, of the sense-bases of contact should be understood in accordance with the method mentioned in the foundation of feeling, with "By the arising of ignorance, the arising of eye-consciousness" and so on. However, just as there "By the arising of contact, by the cessation of contact" is said, similarly here, concerning the eye and so on, it should be understood "By the arising of nutriment, by the cessation of nutriment." Concerning the mind-base, "By the arising of name-and-form, by the cessation of name-and-form."
145. Sau khi giảng về luân hồi của các quan điểm và chấp trước như vậy, giờ đây, bắt đầu bằng "Khi nào, này các Tỳ-kheo, vị Tỳ-kheo" v.v..., Ngài chỉ ra sự xuất ly sau khi bắt đầu bằng vị Tỳ-kheo đã thành tựu. Ở đây, "khi nào" nghĩa là vào lúc nào. "Của sáu xúc xứ" nghĩa là, của chính sáu xúc xứ mà do xúc chạm rồi cảm nghiệm bằng chúng, luân hồi của những người theo kiến chấp diễn ra. Trong "sự sinh khởi" v.v..., sự sinh khởi v.v... của các xúc xứ nên được hiểu theo phương pháp được nói trong trạm niệm thọ, "do vô minh sinh khởi, nhãn sinh khởi" v.v... Nhưng như ở đó được nói, "do xúc sinh khởi, do xúc diệt", thì ở đây, trong nhãn v.v... đó – "do thức ăn sinh khởi, do thức ăn diệt" nên được hiểu. Trong ý xứ, "do danh sắc sinh khởi, do danh sắc diệt".
145. Evaṃ diṭṭhigatikādhiṭṭhānaṃ vaṭṭaṃ kathetvā idāni yuttayogabhikkhuadhiṭṭhānaṃ katvā vivaṭṭaṃ dassento – ‘‘yato kho, bhikkhave, bhikkhū’’tiādimāha. Tattha yatoti yadā. Channaṃ phassāyatanānanti yehi chahi phassāyatanehi phusitvā paṭisaṃvedayamānānaṃ diṭṭhigatikānaṃ vaṭṭaṃ vattati, tesaṃyeva channaṃ phassāyatanānaṃ. Samudayantiādīsu avijjāsamudayā cakkhusamudayotiādinā vedanākammaṭṭhāne vuttanayena phassāyatanānaṃ samudayādayo veditabbā. Yathā pana tattha ‘‘phassasamudayā phassanirodhā’’ti vuttaṃ, evamidha, taṃ cakkhādīsu – ‘‘āhārasamudayā āhāranirodhā’’ti veditabbaṃ. Manāyatane ‘‘nāmarūpasamudayā nāmarūpanirodhā’’ti.
Understands exceedingly, means the one engaged in views knows only the view. But this one knows exceedingly the view and beyond the view, virtue, concentration, wisdom, liberation, up to Arahatship. Who knows this? The one whose corruptions are destroyed knows, the non-returner, the once-returner, the stream-enterer, the one who has heard much, the monk who carries the texts, the one who has aroused insight knows. The teaching, however, is concluded with the pinnacle of Arahatship.
"Liễu tri một cách cao thượng hơn" nghĩa là người theo kiến chấp chỉ biết kiến chấp. Nhưng vị này liễu tri một cách cao thượng hơn, vượt lên trên kiến chấp và từ kiến chấp, giới, định, tuệ, giải thoát cho đến A-la-hán quả. Ai liễu tri như vậy? Vị đã đoạn tận các lậu hoặc liễu tri, vị Bất lai, vị Nhất lai, vị Dự lưu, vị đa văn, vị Tỳ-kheo trì tụng kinh điển liễu tri, vị đã bắt đầu tu tập minh sát liễu tri. Nhưng bài giảng được kết thúc bằng A-la-hán quả.
Uttaritaraṃ pajānātīti diṭṭhigatiko diṭṭhimeva jānāti. Ayaṃ pana diṭṭhiñca diṭṭhito ca uttaritaraṃ sīlasamādhipaññāvimuttinti yāva arahattā jānāti. Ko evaṃ jānātīti? Khīṇāsavo jānāti, anāgāmī, sakadāgāmī, sotāpanno, bahussuto, ganthadharo bhikkhu jānāti, āraddhavipassako jānāti. Desanā pana arahattanikūṭeneva niṭṭhāpitāti.
146. Having thus spoken of turning away, now, in order to show "There is no one engaged in views who is free from the net of this teaching," again he began - "Whatever, monks." Therein, included within this net, means included within this, my net of teaching. Bound by this, means clinging to this, my net of teaching, dwelling within it. Emerging, they emerge, what is said? Even though they sink down, and even though they rise up, bound by my net of teaching, they sink and they rise. Included within this, means included within this, my net of teaching, by this bound and included within this net, emerging they emerge, there is no one engaged in views who is not included here, meaning they are included in this net.
146. Sau khi giảng về sự xuất ly như vậy, giờ đây, để chỉ rõ rằng "không có người theo kiến chấp nào thoát khỏi lưới giáo pháp", Ngài bắt đầu: "Bất cứ ai, này các Tỳ-kheo". Ở đây, "bị giam trong lưới" nghĩa là bị giam trong chính lưới giáo pháp này của ta. "Bị mắc vào đây" nghĩa là bị mắc, bị dính vào trong lưới giáo pháp này của ta. "Nổi lên rồi lại nổi lên" nghĩa là gì? Dù họ chìm xuống phía dưới hay trồi lên phía trên, họ vẫn bị mắc trong lưới giáo pháp của ta, chìm xuống và trồi lên. "Bị bao trùm ở đây" nghĩa là bị bao trùm trong lưới giáo pháp này của ta, bị trói buộc bởi cái này, bị giam trong lưới và nổi lên rồi lại nổi lên, không có người theo kiến chấp nào không bị bao gồm ở đây.
146. Evaṃ vivaṭṭaṃ kathetvā idāni ‘‘desanājālavimutto diṭṭhigatiko nāma natthī’’ti dassanatthaṃ puna – ‘‘ye hi keci, bhikkhave’’ti ārabhi. Tattha antojālīkatāti imassa mayhaṃ desanājālassa antoyeva katā. Ettha sitā vāti etasmiṃ mama desanājāle sitā nissitā avasitāva. Ummujjamānā ummujjantīti kiṃ vuttaṃ hoti? Te adho osīdantāpi uddhaṃ uggacchantāpi mama desanājāle sitāva hutvā osīdanti ca uggacchanti ca. Ettha pariyāpannāti ettha mayhaṃ desanājāle pariyāpannā, etena ābaddhā antojālīkatā ca hutvā ummujjamānā ummujjanti, na hettha asaṅgahito diṭṭhigatiko nāma atthīti.
With fine mesh, means with delicate holes, with a fine mesh. The Blessed One is like a fisherman, the teaching is like a net, the ten-thousand-world system is like a small body of water, those engaged in the sixty-two views are like large creatures. Just as seeing the inclusion of large creatures within the net for one standing on the shore and looking, so too, for the Blessed One, is the seeing of the inclusion of all those engaged in views within the net of the teaching, thus the comparison should be understood here.
"Với lưới mắt nhỏ" nghĩa là với lưới dày đặc, với các lỗ lưới nhỏ. Giống như người đánh cá, Đức Thế Tôn, giống như cái lưới, giáo pháp, giống như vùng nước nhỏ, mười ngàn thế giới, giống như các sinh vật lớn, sáu mươi hai người theo kiến chấp. Giống như việc thấy các sinh vật lớn bị giam trong lưới của người đứng trên bờ và nhìn xuống, Đức Thế Tôn thấy tất cả những người theo kiến chấp bị giam trong lưới giáo pháp, sự so sánh ở đây nên được hiểu như vậy.
Sukhumacchikenāti saṇhaacchikena sukhumacchiddenāti attho. Kevaṭṭo viya hi bhagavā, jālaṃ viya desanā, parittaudakaṃ viya dasasahassilokadhātu, oḷārikā pāṇā viya dvāsaṭṭhidiṭṭhigatikā. Tassa tīre ṭhatvā olokentassa oḷārikānaṃ pāṇānaṃ antojālīkatabhāvadassanaṃ viya bhagavato sabbadiṭṭhigatānaṃ desanājālassa antokatabhāvadassananti evamettha opammasaṃsandanaṃ veditabbaṃ.
147. Thus, having shown that all speculative views are included in these sixty-two, and that all those holding speculative views are caught within this net of teaching, he now speaks these words, "The Tathagata's body, monks, stands with the cord of being severed", to show that he is not caught in any of them. That by which they lead is a cord. By "they lead" is meant they drag, after tying around the neck; this is a name for a rope. Here, however, the craving for existence is intended as a cord, due to its similarity. For it leads the multitude, tying them by the neck, leading them to this or that state of existence, hence it is the cord of being. One whose cord of being is severed by the noble eightfold path's sword is called one with the cord of being severed.
147. Như vậy, bằng sáu mươi hai tà kiến này, hiển thị sự bao hàm tất cả tà kiến, tất cả những người có kiến chấp đều rơi vào trong lưới giáo pháp này, bây giờ, để hiển thị bản thân không rơi vào bất cứ đâu, Ngài nói: "Này các Tỳ-kheo, Như Lai đã đoạn trừ mầm mống tái sinh". Trong đó, cái gì dẫn dắt, cái đó là lưới (netti). Dẫn dắt (nayanti) nghĩa là cột vào cổ rồi kéo đi, đó là tên gọi của sợi dây. Ở đây, vì tương đồng với lưới, nên tham ái (taṇhā) của hữu (bhava) được xem là lưới. Vì nó cột vào cổ của chúng sinh, dẫn dắt và đưa họ đến những cảnh giới khác nhau, nên tham ái của hữu được gọi là lưới hữu (bhavanetti). Vị ấy đã chặt đứt lưới hữu bằng gươm trí tuệ của đạo A-la-hán, nên gọi là bậc đã đoạn trừ lưới hữu (ucchinnabhavanettiko).
147. Evaṃ imāhi dvāsaṭṭhiyā diṭṭhīhi sabbadiṭṭhīnaṃ saṅgahitattā sabbesaṃ diṭṭhigatikānaṃ etasmiṃ desanājāle pariyāpannabhāvaṃ dassetvā idāni attano katthaci apariyāpannabhāvaṃ dassento – ‘‘ucchinnabhavanettiko, bhikkhave, tathāgatassa kāyo’’tiādimāha. Tattha nayanti etāyāti netti. Nayantīti gīvāya bandhitvā ākaḍḍhanti, rajjuyā etaṃ nāmaṃ. Idha pana nettisadisatāya bhavataṇhā nettīti adhippetā. Sā hi mahājanaṃ gīvāya bandhitvā taṃ taṃ bhavaṃ neti upanetīti bhavanetti. Arahattamaggasatthena ucchinnā bhavanetti assāti ucchinnabhavanettiko.
Beyond the dissolution of the body is from the dissolution of the body upwards. Because life has completely ended, it means having been exhausted, meaning the state of non-relinking after that. They will not see him means gods or men will not see the Tathagata, meaning he will come to the state of being un-designatable.
Sau khi thân hoại, (uddhanti) nghĩa là vượt lên trên sự tan rã của thân. Vì sự sống hoàn toàn kết thúc, cạn kiệt, có nghĩa là không còn tái sinh nữa. Họ sẽ không thấy Ngài (na taṃ dakkhanti), nghĩa là chư thiên hay loài người sẽ không thấy Như Lai, Ngài sẽ đạt đến trạng thái không thể trình bày được.
Kāyassa bhedā uddhanti kāyassa bhedato uddhaṃ. Jīvitapariyādānāti jīvitassa sabbaso pariyādinnattā parikkhīṇattā, puna appaṭisandhikabhāvāti attho. Na taṃ dakkhantīti taṃ tathāgataṃ. Devā vā manussā vā na dakkhissanti, apaṇṇattikabhāvaṃ gamissatīti attho.
Just as, monks, this is a presentation through a simile. For the Tathagata's body is like a mango tree, the craving that previously arose dependent on it is like the large stalk that grows on the tree. Like a cluster of mangoes attached to that stalk, numbering five-fold, twelve-fold, or eighteen-fold, the five aggregates, twelve sense bases, and eighteen elements that arise in the future, existing because of craving, are conditioned by craving. But just as when that stalk is cut, all those mangoes go along with it, following that very stalk, meaning that by the cutting of the stalk, they are cut; in the same way, the five aggregates, twelve sense bases, and eighteen elements that might arise in the future due to the non-cutting of the stalk that is the cord of being, all those phenomena follow it, they go along with the cord of being, and when that is cut, they are cut.
Này các Tỳ-kheo, ví như (seyyathāpi, bhikkhave), ở đây là sự so sánh bằng ví dụ. Thân của Như Lai giống như cây xoài, tham ái trước đây khởi lên nương vào thân ấy giống như cuống lớn sinh ra trên cây. Khi có tham ái, năm uẩn, mười hai xứ, mười tám giới nương vào tham ái ấy mà sinh ra trong tương lai, giống như chùm xoài với số lượng năm, mười hai, mười tám quả, kết nối vào cuống ấy. Như khi cuống ấy bị chặt, tất cả những quả xoài ấy đều tùy thuộc vào nó, đi theo cuống ấy, có nghĩa là khi cuống bị chặt thì chúng cũng bị chặt; cũng vậy, tất cả những pháp như năm uẩn, mười hai xứ, mười tám giới, mà đáng lẽ sẽ sinh ra trong tương lai do lưới hữu là cuống chưa bị chặt đứt, đều tùy thuộc vào nó, đi theo lưới hữu, khi lưới hữu bị chặt thì chúng cũng bị chặt.
Seyyathāpi, bhikkhaveti, upamāyaṃ pana idaṃ saṃsandanaṃ. Ambarukkho viya hi tathāgatassa kāyo, rukkhe jātamahāvaṇṭo viya taṃ nissāya pubbe pavattataṇhā. Tasmiṃ vaṇṭe upanibaddhā pañcapakkadvādasapakkaaṭṭhārasapakkaparimāṇā ambapiṇḍī viya taṇhāya sati taṇhūpanibandhanā hutvā āyatiṃ nibbattanakā pañcakkhandhā dvādasāyatanāni aṭṭhārasa dhātuyo. Yathā pana tasmiṃ vaṇṭe chinne sabbāni tāni ambāni tadanvayāni honti, taṃyeva vaṇṭaṃ anugatāni, vaṇṭacchedā chinnāni yevāti attho; evameva ye bhavanettivaṇṭassa anupacchinnattā āyatiṃ uppajjeyyuṃ pañcakkhandhā dvādasāyatanāni aṭṭhārasadhātuyo, sabbe te dhammā tadanvayā honti bhavanettiṃ anugatā, tāya chinnāya chinnā yevāti attho.
Just as even when that very tree, coming into contact with frog-spawn, poison, gradually dries up and dies - there is only the utterance "in this place there was such and such a tree," and no one sees that tree, so too, having come into contact with the noble path, due to the exhaustion of the affection of craving, gradually drying up as it were, when this body is dissolved, beyond the dissolution of the body, life having ended, they will not see him, even the Tathagata, gods and men will not see, there will only be the utterance that this was the teaching of the awakened one of such a name, thus he brought the teaching to a close, attaining the element of Nibbana without residue.
Như khi trên cây ấy, bị ảnh hưởng bởi nọc độc của cóc, gai, dần dần khô héo và chết - chỉ còn lại lời nói: "Ở nơi này đã từng có một cây như thế", không ai thấy cây ấy, cũng vậy, khi thân này, bị ảnh hưởng bởi đạo lộ của bậc Thánh, do sự cạn kiệt ái dục mà dần dần khô héo, sau khi thân hoại, do mạng sống đã tận, họ sẽ không thấy Ngài, chư thiên và loài người cũng sẽ không thấy Như Lai, chỉ còn lại lời nói: "Giáo pháp này là của bậc Đạo Sư như thế", Ngài đã kết thúc bài pháp bằng cách đạt đến Niết Bàn giới vô dư (anupādisesanibbānadhātu).
Yathā pana tasmimpi rukkhe maṇḍūkakaṇṭakavisasamphassaṃ āgamma anupubbena sussitvā mate – ‘‘imasmiṃ ṭhāne evarūpo nāma rukkho ahosī’’ti vohāramattameva hoti, na taṃ rukkhaṃ koci passati, evaṃ ariyamaggasamphassaṃ āgamma taṇhāsinehassa pariyādinnattā anupubbena sussitvā viya bhinne imasmiṃ kāye, kāyassa bhedā uddhaṃ jīvitapariyādānā na taṃ dakkhanti, tathāgatampi devamanussā na dakkhissanti, evarūpassa nāma kira satthuno idaṃ sāsananti vohāramattameva bhavissatīti anupādisesanibbānadhātuṃ pāpetvā desanaṃ niṭṭhapesi.
148. When this was said, the Venerable Ananda: when the Blessed One had delivered this sutta, the elder, recalling the whole sutta from beginning to end, and thinking, "The Blessed One, having expounded the sutta, shining forth the power of a Buddha, has not taken a name for it; now I shall cause him to take a name for it," spoke these words to the Blessed One.
148. Khi nghe như vậy, Tôn giả Ananda (evaṃvutte āyasmā ānandoti), nghĩa là khi Đức Thế Tôn nói xong bài Kinh này, Tôn giả suy ngẫm toàn bộ bài Kinh từ đầu, thấy rằng Đức Thế Tôn đã giảng về sức mạnh của chư Phật, nhưng không nêu tên của bài Kinh, bèn nghĩ: "Ta hãy xin Ngài đặt tên cho bài Kinh này", rồi bạch Đức Thế Tôn:
148.Evaṃvutte āyasmā ānandoti evaṃ bhagavatā imasmiṃ sutte vutte thero ādito paṭṭhāya sabbaṃ suttaṃ samannāharitvā evaṃ buddhabalaṃ dīpetvā kathitasuttassa na bhagavatā nāmaṃ gahitaṃ, handassa nāmaṃ gaṇhāpessāmīti cintetvā bhagavantaṃ etadavoca.
Therefore, here, in the words "therefore, here, you," and so on, this is the connection of meaning – Ananda, since in this discourse both this world's benefit and the next world's are explained, therefore, here, you may remember this discourse as "the Net of Aims"; since many things of the teaching have been spoken, therefore also remember it as "the Net of the Doctrine"; and since here the supreme, meaning all-knowing knowledge, has been explained, therefore also remember it as "the Supreme Net"; since here sixty-two speculative views have been explained, therefore also remember it as "the Net of Views"; and since, having heard this discourse, one is able to overcome the Mara of the aggregates, the Mara of death, and the Mara of defilements, therefore remember it as "the Unsurpassed Victory in Battle".
Do vậy, này Ananda (tasmātiha tvantiādīsu), ý nghĩa được nối kết như sau – Ananda, vì trong pháp môn (dhammapariyāya) này, cả nghĩa hiện tại (idhattho) và nghĩa vị lai (paratthopi) đều được phân tích, nên ông hãy ghi nhớ pháp môn này là "Lưới của nghĩa (atthajāla)"; vì ở đây, nhiều pháp (tantidhamma) liên quan đến giáo lý đã được nói, nên hãy ghi nhớ nó là "Lưới của Pháp (dhammajāla)"; và vì ở đây, trí tuệ toàn giác (sabbaññutaññāṇa), tối thượng (brahmaṃ) đã được phân tích, nên hãy ghi nhớ nó là "Lưới của Phạm (brahmajāla)"; vì ở đây, sáu mươi hai tà kiến đã được phân tích, nên hãy ghi nhớ nó là "Lưới của Kiến (diṭṭhijāla)"; vì khi nghe pháp môn này, có thể hàng phục được thiên ma (devaputtamāra), uẩn ma (khandhamāra), tử ma (maccumāra), phiền não ma (kilesamāra), nên hãy ghi nhớ nó là "Chiến thắng tối thượng trong trận chiến (anuttaro saṅgāmavijayoti)".
Tasmātiha tvantiādīsu ayamatthayojanā – ānanda, yasmā imasmiṃ dhammapariyāye idhatthopi paratthopi vibhatto, tasmātiha tvaṃ imaṃ dhammapariyāyaṃ ‘‘atthajāla’’ntipi naṃ dhārehi; yasmā panettha bahū tantidhammā kathitā, tasmā ‘‘dhammajāla’’ntipi naṃ dhārehi; yasmā ca ettha seṭṭhaṭṭhena brahmaṃ sabbaññutaññāṇaṃ vibhattaṃ, tasmā ‘‘brahmajāla’’ntipi naṃ dhārehi; yasmā ettha dvāsaṭṭhidiṭṭhiyo vibhattā, tasmā ‘‘diṭṭhijāla’’ntipi naṃ dhārehi; yasmā pana imaṃ dhammapariyāyaṃ sutvā devaputtamārampi khandhamārampi maccumārampi kilesamārampi sakkā maddituṃ, tasmā ‘‘anuttaro saṅgāmavijayotipi naṃ dhārehī’’ti.
The Blessed One spoke this, from the setting forth of the source and conclusion up to "remember it as the Unsurpassed Victory in Battle". The Blessed One spoke the entire sutta, supremely profound, unestablished, unable to be lead into another's mind, revealing all-knowing knowledge, dispelling the great darkness of speculative views like the sun dispels the darkness.
Đức Thế Tôn đã nói như vậy (idamavoca bhagavāti), Đức Thế Tôn, bắt đầu từ nguyên nhân và phần kết thúc cho đến "hãy ghi nhớ nó là 'Chiến thắng tối thượng trong trận chiến'", đã nói toàn bộ bài Kinh này, không thể lay chuyển, cực kỳ thâm sâu đối với người khác, hiển thị trí tuệ toàn giác, như mặt trời xua tan bóng tối, tiêu trừ bóng tối dày đặc của tà kiến.
Idamavoca bhagavāti idaṃ nidānāvasānato pabhuti yāva ‘‘anuttaro saṅgāmavijayotipi naṃ dhārehī’’ti sakalaṃ suttantaṃ bhagavā paresaṃ paññāya alabbhaneyyapatiṭṭhaṃ paramagambhīraṃ sabbaññutaññāṇaṃ pakāsento sūriyo viya andhakāraṃ diṭṭhigatamahandhakāraṃ vidhamanto avoca.
149. Those monks, delighted, means those monks with their minds delighted, their own minds, with their thoughts uplifted by the rapture towards the Buddha. The word of the Blessed One, this sutta, endowed with the elegance of diverse methods of teaching, spoken by the Blessed One with a voice like that of the kalavinka bird, delightful to the ear, like an ambrosial anointing of the hearts of the wise, means they rejoiced and accepted. For this word 'rejoiced' occurs in such passages as, "he rejoices, he speaks" in the sense of craving. Also, in such passages as, "gods and humans only rejoice in food" in the sense of approaching.
"Relatives, friends, and well-wishers,
Rejoice at a man's safe return from afar" (Dhammapada verse 219);
149. Các vị Tỳ-kheo ấy hoan hỷ (attamanā te bhikkhūti), nghĩa là các vị Tỳ-kheo ấy hoan hỷ, tâm ý vui vẻ, hân hoan với niềm tin kính Đức Phật. Lời Đức Thế Tôn dạy (bhagavato bhāsitanti), bài Kinh này với vẻ đẹp của những phương pháp thuyết giảng đa dạng, lời của Đức Thế Tôn, Đấng nói bằng Phạm âm (brahmassarena) như tiếng hót dịu dàng của chim Karavika, êm tai, như sự tưới tẩm cam lồ cho trái tim của những người trí. Tán thán (abhinandunti), nghĩa là tùy hỷ và chấp nhận. Vì chữ tán thán này – "tán thán, ca ngợi (abhinandati abhivadatī)" (Tương Ưng Bộ Kinh 3.5), cũng xuất hiện với nghĩa tham ái. "Chỉ tán thán đồ ăn, cả chư thiên và loài người" (Tương Ưng Bộ Kinh 1.43), với nghĩa hướng đến.
"Người thân, bạn bè và bằng hữu,
Tán thán người đi xa lâu ngày,
Trở về bình an từ phương xa." (Pháp Cú 219);
149.Attamanā te bhikkhūti te bhikkhū attamanā sakamanā, buddhagatāya pītiyā udaggacittā hutvāti vuttaṃ hoti. Bhagavato bhāsitanti evaṃ vicitranayadesanāvilāsayuttaṃ idaṃ suttaṃ karavīkarutamañjunā kaṇṇasukhena paṇḍitajanahadayānaṃ amatābhisekasadisena brahmassarena bhāsamānassa bhagavato vacanaṃ. Abhinandunti anumodiṃsu ceva sampaṭicchiṃsu ca. Ayañhi abhinandasaddo – ‘‘abhinandati abhivadatī’’tiādīsu (saṃ. ni. 3.5) taṇhāyampi āgato. ‘‘Annamevābhinandanti, ubhaye devamānusā’’tiādīsu (saṃ. ni. 1.43) upagamanepi.
‘‘Cirappavāsiṃ purisaṃ, dūrato sotthimāgataṃ;
Ñātimittā suhajjā ca, abhinandanti āgata’’nti. (dha. pa. 219);
In such passages as "having rejoiced, having approved" in the sense of approval. Here it is appropriate in the senses of approval and acceptance. Therefore it was said, "they rejoiced means they approved and accepted."
Trong các trường hợp trên, có nghĩa là chấp nhận. "Sau khi tán thán, tùy hỷ" (Trung Bộ Kinh 1.205), có nghĩa là tùy hỷ. Ở đây, nó phù hợp với nghĩa tùy hỷ và chấp nhận. Vì vậy, nói rằng – "tán thán, nghĩa là tùy hỷ và chấp nhận".
Ādīsu sampaṭicchanepi. ‘‘Abhinanditvā anumoditvā’’tiādīsu (ma. ni. 1.205) anumodanepi. Svāyamidha anumodanasampaṭicchanesu yujjati. Tena vuttaṃ – ‘‘abhinandunti anumodiṃsu ceva sampaṭicchiṃsu cā’’ti.
Fine words, well spoken, "good, good," thus saying;
"Những lời hay, những lời tốt, 'lành thay, lành thay', như vậy;
Subhāsitaṃ sulapitaṃ, ‘‘sādhu sādhū’’ti tādino;
Approving with bowed heads, the monks accepted.
Các vị Tỳ-kheo tùy hỷ, chấp nhận bằng cả tấm lòng."
Anumodamānā sirasā, sampaṭicchiṃsu bhikkhavoti.
And in this discourse means in this sutta without untruths. For this has been called a discourse because it is without untruths.
Và trong bài Kinh (veyyākaraṇasminti) này, bài Kinh không có kệ tụng này. Vì không có kệ tụng, nên bài Kinh này được gọi là Kinh (veyyākaraṇa).
Imasmiñca pana veyyākaraṇasminti imasmiṃ niggāthakasutte. Niggāthakattā hi idaṃ veyyākaraṇanti vuttaṃ.
The ten-thousand-world-system means the world-system to the extent of ten thousand world-spheres. Quaked should not be understood as it quaked only at the end of the sutta. For it is said, "while it was being spoken". Therefore, it should be understood that as the sixty-two speculative views were being untangled and taught, at the end of each and every one of those speculative views, it quaked in sixty-two instances.
Thế giới một vạn (dasasahassīlokadhātūti), thế giới có kích thước của một vạn cõi. Rung động (akampitthāti), không phải chỉ rung động ở phần kết thúc bài Kinh. Vì nói rằng "trong khi đang nói (bhaññamāneti)". Vì vậy, cần phải hiểu là khi sáu mươi hai tà kiến được giải thích, làm cho rõ ràng, ở phần kết thúc của mỗi tà kiến, nghĩa là rung động ở sáu mươi hai chỗ.
Dasasahassīlokadhātūti dasasahassacakkavāḷaparimāṇā lokadhātu. Akampitthāti na suttapariyosāneyeva akampitthāti veditabbā. Bhaññamāneti hi vuttaṃ. Tasmā dvāsaṭṭhiyā diṭṭhigatesu viniveṭhetvā desiyamānesu tassa tassa diṭṭhigatassa pariyosāne pariyosāneti dvāsaṭṭhiyā ṭhānesu akampitthāti veditabbā.
There, the earth-quake should be understood as occurring due to eight causes – by the disturbance of the elements, by the power of one with psychic potency, by a Bodhisatta's descent into the womb, by his emergence from his mother's womb, by his attainment of enlightenment, by his setting in motion the wheel of Dhamma, by his relinquishing of the life-force, and by his final passing away. The determination of these, we shall speak of in the commentary on the text that comes in the Mahaparinibbana Sutta, thus "Ananda, there are these eight reasons, eight causes for the appearance of a great earthquake". But this great earth quaked in eight other instances too – at the great renunciation, at the approach to the seat of enlightenment, at the taking of the dust-heap cloth, at the washing of the dust-heap cloth, at the Kalakarama sutta, at the Gotamaka sutta, at the Vessantara birth story, and in this Brahmajala sutta. There, at the great renunciation and the approach to the seat of enlightenment, it quaked through the power of effort. At the taking of the dust-heap cloth, having renounced four great continents, along with two thousand surrounding islands, having gone to the charnel ground and taken the dust-heap cloth, it was struck by the impact of astonishment at the difficulty accomplished by the Blessed One. At the washing of the dust-heap cloth and the Vessantara birth story, it quaked with untimely quaking. At the Kalakarama and Gotamaka suttas, it quaked with the witnessing of "I, the Blessed One, am witness." But in this Brahmajala sutta, it should be understood that it quaked by way of giving approval as the sixty-two speculative views were being untangled, freed from thickets, and taught.
Ở đây, cần phải hiểu sự rung động của đất do tám nguyên nhân – do sự xáo trộn của các đại (dhātukkhobhena), do thần lực của người có thần thông (iddhimato ānubhāvena), do Bồ-tát nhập thai (bodhisattassa gabbhokkantiyā), do ra khỏi bụng mẹ (mātukucchito nikkhamanena), do chứng đắc Chánh Đẳng Giác (sambodhippattiyā), do chuyển Pháp luân (dhammacakkappavattanena), do xả bỏ thọ hành (āyusaṅkhārossajjanena), do nhập Niết-bàn (parinibbānenāti). Giải thích về những điều này – "Này Ananda, có tám nhân, tám duyên này khiến cho địa chấn lớn xảy ra", chúng ta sẽ nói trong phần giải thích câu chuyện về Đại Bát Niết Bàn (mahāparinibbāne). Nhưng trái đất vĩ đại này cũng rung động ở tám nơi khác – khi xuất gia (mahābhinikkhamane), khi đến Bồ Đề Đạo Tràng (bodhimaṇḍūpasaṅkamane), khi nhận y phấn tảo (paṃsukūlaggahaṇe), khi giặt y phấn tảo (paṃsukūladhovane), trong Kinh Kāḷakārāma (kāḷakārāmasutte), trong Kinh Gotamaka (gotamakasutte), trong Jātaka Vessantara (vessantarajātake), trong Kinh Phạm Võng (brahmajāleti) này. Trong đó, khi xuất gia và đến Bồ Đề Đạo Tràng, rung động do sức mạnh của tinh tấn. Khi nhận y phấn tảo, Đức Thế Tôn đã làm điều khó làm, từ bỏ bốn hòn đảo lớn cùng với hai ngàn hòn đảo nhỏ xung quanh, xuất gia, đến nghĩa địa, nhận y phấn tảo, trái đất rung động vì xúc động bởi sự kỳ diệu. Khi giặt y phấn tảo và trong Jātaka Vessantara, rung động do sự rung động không đúng thời. Trong Kinh Kāḷakārāma và Kinh Gotamaka – "Ta là nhân chứng, Đức Thế Tôn", rung động với tư cách là nhân chứng. Ở đây, trong Kinh Phạm Võng, khi sáu mươi hai tà kiến được giải thích, làm cho rõ ràng, không còn gì, rung động vì sự tán dương công đức.
Tattha aṭṭhahi kāraṇehi pathavīkampo veditabbo – dhātukkhobhena, iddhimato ānubhāvena, bodhisattassa gabbhokkantiyā, mātukucchito nikkhamanena, sambodhippattiyā, dhammacakkappavattanena, āyusaṅkhārossajjanena, parinibbānenāti. Tesaṃ vinicchayaṃ – ‘‘aṭṭha kho ime, ānanda, hetū aṭṭha paccayā mahato bhūmicālassa pātubhāvāyā’’ti evaṃ mahāparinibbāne āgatāya tantiyā vaṇṇanākāle vakkhāma. Ayaṃ pana mahāpathavī aparesupi aṭṭhasu ṭhānesu akampittha – mahābhinikkhamane, bodhimaṇḍūpasaṅkamane, paṃsukūlaggahaṇe, paṃsukūladhovane, kāḷakārāmasutte, gotamakasutte, vessantarajātake, imasmiṃ brahmajāleti. Tattha mahābhinikkhamanabodhimaṇḍūpasaṅkamanesu vīriyabalena akampittha. Paṃsukūlaggahaṇe dvisahassadīpaparivāre cattāro mahādīpe pahāya pabbajitvā susānaṃ gantvā paṃsukūlaṃ gaṇhantena dukkaraṃ bhagavatā katanti acchariyavegābhihatā akampittha. Paṃsukūladhovanavessantarajātakesu akālakampanena akampittha. Kāḷakārāmagotamakasuttesu – ‘‘ahaṃ sakkhī bhagavā’’ti sakkhibhāvena akampittha. Imasmiṃ pana brahmajāle dvāsaṭṭhiyā diṭṭhigatesu vijaṭetvā niggumbaṃ katvā desiyamānesu sādhukāradānavasena akampitthāti veditabbā.
And the earth quaked not only in these instances, but also at the three convocations, and on the day when the great elder Mahinda, having come to this island, sat in the Jotivana and taught the Dhamma, it quaked. And at the Kalyani monastery, when the elder who takes almsfood had swept the courtyard of the shrine and, having sat down there, taking the rapture with the Buddha as object, began this sutta, at the end of the sutta, it quaked down to the water-level. There was a place called Pacinaambalatthika (Eastern Mango Twig Place) of the Lohapasada (Brazen Palace). There, having sat down, the elder reciters of the Digha Nikaya began the Brahmajala Sutta, and at the end of their recitation, the earth quaked down to the water-level.
Thus, by the power of which, it quaked many times;
The earth, of the best of suttas, taught by the self-become one.
Of this Brahmajala, wise people, having carefully learned the Dhamma and the meaning;
May they practice accordingly.
Thus, in the Sumangalavilasini, the commentary to the Digha Nikaya
The exposition of the Brahmajala Sutta is concluded.
Không chỉ ở những nơi này, trái đất mới rung động, mà còn ở ba kỳ kết tập (saṅgahesupi), khi Trưởng lão Mahinda đến hòn đảo này, ngồi ở khu rừng Jotiva, thuyết pháp, trái đất cũng rung động. Và ở Kalyāṇiyavihāra, khi Trưởng lão Piṇḍapātiya quét sân bảo tháp, ngồi ở đó, khởi lên hỷ lạc hướng đến Đức Phật, bắt đầu bài Kinh này, ở phần kết thúc bài Kinh, trái đất rung động đến tận mé nước. Có một nơi tên là pācīnaambalaṭṭhikaṭṭhāna của Lohapāsāda. Các Trưởng lão Dīghabhāṇaka ngồi ở đó, bắt đầu Kinh Phạm Võng, ở phần kết thúc bài tụng của họ, trái đất rung động đến tận mé nước.
Như vậy, do uy lực của bài Kinh thù thắng này,
Mà bậc Tự Tại đã giảng, trái đất đã rung động nhiều lần;
Ở đây, các bậc trí tuệ hãy trân trọng,
Học tập và thực hành Chánh Pháp và ý nghĩa của Kinh Phạm Võng.
Như vậy là phần chú giải Kinh Phạm Võng trong bộ Chú giải Trường Bộ Kinh, Sumaṅgalavilāsinī đã hoàn tất.
Na kevalañca etesu ṭhānesuyeva pathavī akampittha, atha kho tīsu saṅgahesupi mahāmahindattherassa imaṃ dīpaṃ āgantvā jotivane nisīditvā dhammaṃ desitadivasepi akampittha. Kalyāṇiyavihāre ca piṇḍapātiyattherassa cetiyaṅgaṇaṃ sammajjitvā tattheva nisīditvā buddhārammaṇaṃ pītiṃ gahetvā imaṃ suttantaṃ āraddhassa suttapariyosāne udakapariyantaṃ katvā akampittha. Lohapāsādassa pācīnaambalaṭṭhikaṭṭhānaṃ nāma ahosi. Tattha nisīditvā dīghabhāṇakattherā brahmajālasuttaṃ ārabhiṃsu, tesaṃ sajjhāyapariyosānepi udakapariyantameva katvā pathavī akampitthāti.
Evaṃ yassānubhāvena, akampittha anekaso;
Medanī suttaseṭṭhassa, desitassa sayambhunā.
Brahmajālassa tassīdha, dhammaṃ atthañca paṇḍitā;
Sakkaccaṃ uggahetvāna, paṭipajjantu yonisoti.
Iti sumaṅgalavilāsiniyā dīghanikāyaṭṭhakathāyaṃ
Brahmajālasuttavaṇṇanā niṭṭhitā.